BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E19 (585 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.4 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 23 1.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 3.3 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 3.3 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 5.8 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 5.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 5.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 5.8 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 5.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 5.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 5.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 5.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 5.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 5.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 5.8 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 379 GKKYHQCCKCASLFINK*I*NSDLK 453 G K QC KC +NK + NS +K Sbjct: 255 GSKPFQCNKCDYTCVNKSMLNSHMK 279 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 379 GKKYHQCCKCASLFINK*I*NSDLK 453 G K QC KC +NK + NS +K Sbjct: 13 GSKPFQCNKCDYTCVNKSMLNSHMK 37 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 253 KFMNGSKPRNTPVTARPAFS 194 +++N +PRN P A P+ S Sbjct: 23 RWLNSQQPRNVPNFAAPSTS 42 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +2 Query: 332 YYNAGIFTQTLVXLQWARNITNAVNVLHFSSINKY 436 ++ A +TL L W + N + +LH I Y Sbjct: 179 FFGARHGLETLNQLIWFDEVVNELRILHGVEIRDY 213 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 160 NSGGCAFDIVMC 125 N+G CAFD + C Sbjct: 100 NTGRCAFDGICC 111 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 97 LIPYYNILKSTLQCQ 141 L+PYYN K +L+ Q Sbjct: 23 LVPYYNFEKFSLEHQ 37 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 75 NGAPPRSTPPLSTPSNS 91 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 244 NGSKPRNTPVTARPAFS 194 NG+ PR+TP + P+ S Sbjct: 119 NGAPPRSTPPLSTPSNS 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,067 Number of Sequences: 336 Number of extensions: 2337 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -