BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E19 (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) 29 2.1 SB_37249| Best HMM Match : UDPGP (HMM E-Value=6.8e-18) 28 6.4 >SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) Length = 327 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -1 Query: 225 THR*QRDPHSALLTIFCP*IFSILVDVLLTL 133 +H+ Q DPH+A L++ C ++S D L+ + Sbjct: 139 SHKAQEDPHNAFLSLLCHVVYSAEPDWLMNI 169 >SB_37249| Best HMM Match : UDPGP (HMM E-Value=6.8e-18) Length = 427 Score = 27.9 bits (59), Expect = 6.4 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 135 MSKAHPPELKKFMDKKLSIKLNAGRAVTGVLRG 233 +S A P ++K +DK + IKLN G T L G Sbjct: 249 VSHAEPADIKAALDKLVVIKLNGGLGTTMGLVG 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,669,382 Number of Sequences: 59808 Number of extensions: 249048 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -