BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E17 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0085 + 4111333-4111492,4114766-4116044,4116113-4116206,411... 28 5.6 05_06_0046 - 25157093-25157431,25157810-25157928,25158024-251581... 28 5.6 >09_02_0085 + 4111333-4111492,4114766-4116044,4116113-4116206, 4116297-4116545 Length = 593 Score = 28.3 bits (60), Expect = 5.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 468 YSEHPHSSEWQLGNLWW 518 Y +PHS+ W +GNL W Sbjct: 66 YQYNPHSALWDIGNLSW 82 >05_06_0046 - 25157093-25157431,25157810-25157928,25158024-25158189, 25158289-25158415,25158490-25158590,25158719-25158905, 25159000-25159100,25159220-25160194,25160325-25160423, 25160500-25160972,25161307-25161420,25161830-25161900, 25162015-25162086,25162334-25162377 Length = 995 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 17 KQKVTSTMDEHTSTDTVQESSNPTLHVEAPTDCDFNLTP 133 K+KVTS M+++T+ D +S PT T+ + P Sbjct: 122 KRKVTSEMEKNTAKDATASASQPTTKPSFSTNKRIQVKP 160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,739,685 Number of Sequences: 37544 Number of extensions: 224103 Number of successful extensions: 379 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -