BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E17 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_296| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-07) 31 1.1 >SB_296| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-07) Length = 338 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 396 FLMXVVIKKL*SKLGSTRLINCL*YSEHPHSSEWQLGNLWWITIY 530 FL + I L + L S ++NCL H ++S+W L +IT Y Sbjct: 66 FLSSMAICNLLNSLLSAGVVNCLQMMVHLYTSDWSCRVLRYITYY 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,752,004 Number of Sequences: 59808 Number of extensions: 289865 Number of successful extensions: 487 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -