BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E16 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, put... 90 1e-18 At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, put... 85 5e-17 At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, put... 84 7e-17 At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, put... 62 3e-10 At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP pr... 45 5e-05 At4g39090.1 68417.m05535 cysteine proteinase RD19a (RD19A) / thi... 44 7e-05 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 44 1e-04 At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol pro... 42 3e-04 At2g21430.1 68415.m02550 cysteine proteinase A494, putative / th... 42 4e-04 At3g54940.3 68416.m06091 cysteine proteinase, putative contains ... 42 5e-04 At3g54940.2 68416.m06090 cysteine proteinase, putative contains ... 42 5e-04 At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XC... 41 6e-04 At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XC... 41 6e-04 At4g23520.1 68417.m03390 cysteine proteinase, putative contains ... 40 0.001 At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol p... 40 0.002 At4g16190.1 68417.m02457 cysteine proteinase, putative contains ... 40 0.002 At4g11310.1 68417.m01827 cysteine proteinase, putative contains ... 40 0.002 At4g36880.1 68417.m05229 cysteine proteinase, putative strong si... 39 0.003 At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XC... 39 0.003 At3g45310.1 68416.m04892 cysteine proteinase, putative similar t... 39 0.003 At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse... 38 0.004 At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse... 38 0.004 At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) ... 38 0.004 At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG1... 37 0.013 At4g11320.1 68417.m01828 cysteine proteinase, putative contains ... 36 0.018 At1g06260.1 68414.m00662 cysteine proteinase, putative contains ... 36 0.018 At3g48350.1 68416.m05277 cysteine proteinase, putative similar t... 36 0.023 At3g43960.1 68416.m04706 cysteine proteinase, putative contains ... 36 0.023 At5g50260.1 68418.m06224 cysteine proteinase, putative similar t... 36 0.031 At1g29080.1 68414.m03560 peptidase C1A papain family protein con... 35 0.041 At2g27420.1 68415.m03314 cysteine proteinase, putative contains ... 34 0.094 At2g34080.1 68415.m04172 cysteine proteinase, putative contains ... 33 0.22 At3g49340.1 68416.m05394 cysteine proteinase, putative contains ... 31 0.66 At1g29090.1 68414.m03561 peptidase C1A papain family protein con... 31 0.66 At1g03560.1 68414.m00337 pentatricopeptide (PPR) repeat-containi... 31 0.66 At5g07110.1 68418.m00810 prenylated rab acceptor (PRA1) family p... 30 1.5 >At4g01610.1 68417.m00210 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 89.8 bits (213), Expect = 1e-18 Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 4/105 (3%) Frame = +3 Query: 231 LSDEFINTINLKQNS-WKAGRNFP-RDTSFAHLKKIMGV--IEDEHFATLPIKTHKIDLI 398 L DE + +N N+ WKA N + + A K+++GV +HF +PI +H L Sbjct: 43 LQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSL- 101 Query: 399 ASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAMTDRVC 533 LP+ FD R WP C ++ + DQG CGSCWAFGAVE+++DR C Sbjct: 102 -KLPKAFDARTAWPQCTSIGNILDQGHCGSCWAFGAVESLSDRFC 145 >At1g02305.1 68414.m00175 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase [Nicotiana rustica] GI:609175; contains Pfam profile PF00112: Papain family cysteine protease Length = 362 Score = 84.6 bits (200), Expect = 5e-17 Identities = 43/109 (39%), Positives = 61/109 (55%), Gaps = 4/109 (3%) Frame = +3 Query: 231 LSDEFINTINLKQNS-WKAGRNFP-RDTSFAHLKKIMGV--IEDEHFATLPIKTHKIDLI 398 L +E + +N N+ WKA N + + A K+++GV F +PI +H I L Sbjct: 46 LQNEIVKEVNENPNAGWKASFNDRFANATVAEFKRLLGVKPTPKTEFLGVPIVSHDISL- 104 Query: 399 ASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAMTDRVCTYSN 545 LP+ FD R W C ++ + DQG CGSCWAFGAVE+++DR C N Sbjct: 105 -KLPKEFDARTAWSQCTSIGRILDQGHCGSCWAFGAVESLSDRFCIKYN 152 >At4g01610.2 68417.m00211 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica]; contains an unusually short, 5nt exon Length = 359 Score = 84.2 bits (199), Expect = 7e-17 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 4/105 (3%) Frame = +3 Query: 231 LSDEFINTINLKQNS-WKAGRNFP-RDTSFAHLKKIMGV--IEDEHFATLPIKTHKIDLI 398 L DE + +N N+ WKA N + + A K+++GV +HF +PI +H L Sbjct: 43 LQDEIVKKVNENPNAGWKAAINDRFSNATVAEFKRLLGVKPTPKKHFLGVPIVSHDPSL- 101 Query: 399 ASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAMTDRVC 533 LP+ FD R WP C ++ + G CGSCWAFGAVE+++DR C Sbjct: 102 -KLPKAFDARTAWPQCTSIGNILGLGHCGSCWAFGAVESLSDRFC 145 >At1g02300.1 68414.m00173 cathepsin B-like cysteine protease, putative similar to cathepsin B-like cysteine proteinase GI:609175 from [Nicotiana rustica] Length = 379 Score = 62.1 bits (144), Expect = 3e-10 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 22/127 (17%) Frame = +3 Query: 231 LSDEFINTINLKQNS-WKAGRNFP-RDTSFAHLKKIMGVIEDEHFATLPIKTHKIDLIAS 404 L +E + +N N+ WKA N + + A K+++GVI+ A L + + DL Sbjct: 43 LQNEIVKEVNENPNAGWKAAFNDRFANATVAEFKRLLGVIQTPKTAYLGVPIVRHDLSLK 102 Query: 405 LPENFDPRDKWPDCPTLNEVRD--------------------QGSCGSCWAFGAVEAMTD 524 LP+ FD R W C ++ + G CGSCWAFGAVE+++D Sbjct: 103 LPKEFDARTAWSHCTSIRRILVGYILNNVLLWSTITLWFWFLLGHCGSCWAFGAVESLSD 162 Query: 525 RVCTYSN 545 R C N Sbjct: 163 RFCIKYN 169 >At5g60360.1 68418.m07568 cysteine proteinase, putative / AALP protein (AALP) identical to AALP protein GI:7230640 from [Arabidopsis thaliana]; similar to barley aleurain Length = 358 Score = 44.8 bits (101), Expect = 5e-05 Identities = 33/95 (34%), Positives = 48/95 (50%), Gaps = 3/95 (3%) Frame = +3 Query: 240 EFINTINLKQNSWKAGRNFPRDTSFAHLKKIMGVIEDEHFATLPIKTHKIDLIASLPENF 419 + I + N K S+K G N D ++ ++ ATL +HK+ A+LPE Sbjct: 88 DLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLK-GSHKVTE-AALPETK 145 Query: 420 DPRDKWPDCPTLNEVRDQGSCGSCWAF---GAVEA 515 D W + ++ V+DQG CGSCW F GA+EA Sbjct: 146 D----WREDGIVSPVKDQGGCGSCWTFSTTGALEA 176 >At4g39090.1 68417.m05535 cysteine proteinase RD19a (RD19A) / thiol protease identical to cysteine proteinase RD19a, thiol protease SP:P43296, GI:435618 from [Arabidopsis thaliana] Length = 368 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = +3 Query: 366 LPIKTHKIDLIAS--LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP +K ++ + LPE+FD W D + V++QGSCGSCW+F A A+ Sbjct: 120 LPKDANKAPILPTENLPEDFD----WRDHGAVTPVKNQGSCGSCWSFSATGAL 168 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +3 Query: 402 SLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 SLP+ D R K +N V+DQGSCGSCWAF A+ A+ Sbjct: 128 SLPDAIDWRAKG----AVNPVKDQGSCGSCWAFSAIGAV 162 >At1g47128.1 68414.m05222 cysteine proteinase (RD21A) / thiol protease identical to SP|P43297 Cysteine proteinase RD21A precursor (EC 3.4.22.-) {Arabidopsis thaliana}, thiol protease RD21A SP:P43297 from [Arabidopsis thaliana] Length = 462 Score = 42.3 bits (95), Expect = 3e-04 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 1/93 (1%) Frame = +3 Query: 243 FINTINLKQNSWKAG-RNFPRDTSFAHLKKIMGVIEDEHFATLPIKTHKIDLIASLPENF 419 F++ N K S++ G F T+ + K +G ++ ++ + LPE+ Sbjct: 82 FVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSLRYEARVGDELPESI 141 Query: 420 DPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 D R K + EV+DQG CGSCWAF + A+ Sbjct: 142 DWRKKG----AVAEVKDQGGCGSCWAFSTIGAV 170 >At2g21430.1 68415.m02550 cysteine proteinase A494, putative / thiol protease, putative identical to SP:P43295 Probable cysteine proteinase A494 precursor [Arabidopsis thaliana]; strong similarity to cysteine proteinase RD19A (thiol protease) GI:435618, SP:P43296 from [Arabidopsis thaliana] Length = 361 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +3 Query: 402 SLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 +LPE FD W D + V++QGSCGSCW+F A+ Sbjct: 131 NLPEEFD----WRDRGAVTPVKNQGSCGSCWSFSTTGAL 165 >At3g54940.3 68416.m06091 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 368 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 396 IASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEA 515 + LPE+FD R+K + EV++QG+CGSCWAF A Sbjct: 134 VDGLPEDFDWREKGG----VTEVKNQGACGSCWAFSTTGA 169 >At3g54940.2 68416.m06090 cysteine proteinase, putative contains similarity to cysteine proteinase GI:479060 from [Glycine max] Length = 211 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 396 IASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEA 515 + LPE+FD R+K + EV++QG+CGSCWAF A Sbjct: 134 VDGLPEDFDWREKGG----VTEVKNQGACGSCWAFSTTGA 169 >At4g35350.2 68417.m05022 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 288 Score = 41.1 bits (92), Expect = 6e-04 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Frame = +3 Query: 246 INTINLKQNSWKAGRNFPRDTSFAHLK-KIMGVIEDEHFATL-PIKTHKIDLIASLPENF 419 I+ N + NS+ G N D + K + +G+ + + P + I LP++ Sbjct: 82 IDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSV 141 Query: 420 DPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 D R K P V+DQG CGSCWAF V A+ Sbjct: 142 DWRKKGAVAP----VKDQGQCGSCWAFSTVAAV 170 >At4g35350.1 68417.m05023 cysteine endopeptidase, papain-type (XCP1) identical to papain-type cysteine endopeptidase XCP1 GI:6708181 from [Arabidopsis thaliana] Length = 355 Score = 41.1 bits (92), Expect = 6e-04 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Frame = +3 Query: 246 INTINLKQNSWKAGRNFPRDTSFAHLK-KIMGVIEDEHFATL-PIKTHKIDLIASLPENF 419 I+ N + NS+ G N D + K + +G+ + + P + I LP++ Sbjct: 82 IDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSV 141 Query: 420 DPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 D R K P V+DQG CGSCWAF V A+ Sbjct: 142 DWRKKGAVAP----VKDQGQCGSCWAFSTVAAV 170 >At4g23520.1 68417.m03390 cysteine proteinase, putative contains similarity to cysteine proteinase (thiol protease) RD21A GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 356 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LPE+ D W ++E++DQG+C SCWAF V A+ Sbjct: 133 LPESVD----WRQEGAVSEIKDQGTCNSCWAFSTVAAV 166 >At5g43060.1 68418.m05256 cysteine proteinase, putative / thiol protease, putative similar to cysteine proteinase RD21A precursor (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 463 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +3 Query: 402 SLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 +LP++ D W + +V+DQGSCGSCWAF + A+ Sbjct: 137 ALPDSVD----WRKEGAVADVKDQGSCGSCWAFSTIGAV 171 >At4g16190.1 68417.m02457 cysteine proteinase, putative contains similarity to papain-like cysteine proteinase isoform I GI:7381219 from [Ipomoea batatas] Length = 373 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 366 LPIKTHKIDLI--ASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP T ++ + LP FD W + + V++QG CGSCW+F A+ A+ Sbjct: 125 LPTDTQTAPILPTSDLPTEFD----WREQGAVTPVKNQGMCGSCWSFSAIGAL 173 >At4g11310.1 68417.m01827 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 364 Score = 39.5 bits (88), Expect = 0.002 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 4/96 (4%) Frame = +3 Query: 243 FINTINLKQNSWKAGRNFPRDTSFAHLKKIMGVIEDE----HFATLPIKTHKIDLIASLP 410 FIN N + S++ G D S K++ + H +K LP Sbjct: 79 FINNRNAENLSYRLGLTGFADLSLHEYKEVCHGADPRPPRNHVFMTSSDRYKTSADDVLP 138 Query: 411 ENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 ++ D W + + EV+DQG C SCWAF V A+ Sbjct: 139 KSVD----WRNEGAVTEVKDQGHCRSCWAFSTVGAV 170 >At4g36880.1 68417.m05229 cysteine proteinase, putative strong similarity to cysteine proteinase COT44 precursor SP:P25251 from [Brassica napus] (Rape) Length = 376 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 +PE D R K +N ++DQG+CGSCWAF A+ Sbjct: 145 VPETVDWRQKG----AVNPIKDQGTCGSCWAFSTTAAV 178 >At1g20850.1 68414.m02612 cysteine endopeptidase, papain-type (XCP2) identical to papain-type cysteine endopeptidase XCP2 GI:6708183 from [Arabidopsis thaliana] Length = 356 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/41 (43%), Positives = 27/41 (65%) Frame = +3 Query: 396 IASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 + ++P++ D R K + EV++QGSCGSCWAF V A+ Sbjct: 135 VEAVPKSVDWRKKG----AVAEVKNQGSCGSCWAFSTVAAV 171 >At3g45310.1 68416.m04892 cysteine proteinase, putative similar to AALP protein GI:7230640 from [Arabidopsis thaliana] and barley aleurain Length = 358 Score = 38.7 bits (86), Expect = 0.003 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 3/95 (3%) Frame = +3 Query: 240 EFINTINLKQNSWKAGRNFPRDTSFAHLKKIMGVIEDEHFATLPIKTHKIDLIASLPENF 419 + I + N K S+K N D ++ ++ ATL +HKI A++P+ Sbjct: 88 DLIRSTNKKGLSYKLSLNQFADLTWQEFQRYKLGAAQNCSATLK-GSHKITE-ATVPDTK 145 Query: 420 DPRDKWPDCPTLNEVRDQGSCGSCWAF---GAVEA 515 D W + ++ V++QG CGSCW F GA+EA Sbjct: 146 D----WREDGIVSPVKEQGHCGSCWTFSTTGALEA 176 >At3g19400.2 68416.m02460 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 290 Score = 38.3 bits (85), Expect = 0.004 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP+ D W + V+DQG+CGSCWAF AV A+ Sbjct: 130 LPDEVD----WRANGAVVSVKDQGNCGSCWAFSAVGAV 163 >At3g19400.1 68416.m02461 cysteine proteinase, putative non-consensus AT acceptor site at exon 3; contains similarity to cysteine protease CYP1 GI:2828252, TDI-65 GI:5726641 from [Lycopersicon esculentum] Length = 362 Score = 38.3 bits (85), Expect = 0.004 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP+ D W + V+DQG+CGSCWAF AV A+ Sbjct: 130 LPDEVD----WRANGAVVSVKDQGNCGSCWAFSAVGAV 163 >At1g09850.1 68414.m01109 cysteine protease, papain-like (XBCP3) identical to papain-like cysteine peptidase XBCP3 GI:14600257 from [Arabidopsis thaliana]; contains Pfam profiles PF00112: Papain family cysteine protease and PF00396: Granulin Length = 437 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + V+DQGSCG+CW+F A AM Sbjct: 124 WRKKGAVTNVKDQGSCGACWSFSATGAM 151 >At5g45890.1 68418.m05644 senescence-specific SAG12 protein (SAG12) / cysteine proteinase, putative identical to senescence-specific protein SAG12 GI:1046373 from [Arabidopsis thaliana] Length = 346 Score = 36.7 bits (81), Expect = 0.013 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = +3 Query: 402 SLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 +LP + D R K P +++QGSCG CWAF AV A+ Sbjct: 129 ALPVSVDWRKKGAVTP----IKNQGSCGCCWAFSAVAAI 163 >At4g11320.1 68417.m01828 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 371 Score = 36.3 bits (80), Expect = 0.018 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP++ D W + + EV+DQG C SCWAF V A+ Sbjct: 144 LPKSVD----WRNEGAVTEVKDQGLCRSCWAFSTVGAV 177 >At1g06260.1 68414.m00662 cysteine proteinase, putative contains similarity to thiol-protease, pre-pro-TPE4A protein GI:3688528 [Pisum sativum] Length = 343 Score = 36.3 bits (80), Expect = 0.018 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + +R+QG CG CWAF AV A+ Sbjct: 133 WRTQGAVTPIRNQGKCGGCWAFSAVAAI 160 >At3g48350.1 68416.m05277 cysteine proteinase, putative similar to cysteine endopeptidase precursor [Ricinus communis] GI:2944446; contains Pfam profile PF00112: Papain family cysteine protease Length = 364 Score = 35.9 bits (79), Expect = 0.023 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + + EV++Q CGSCWAF V A+ Sbjct: 132 WREKGAVTEVKNQQDCGSCWAFSTVAAV 159 >At3g43960.1 68416.m04706 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 376 Score = 35.9 bits (79), Expect = 0.023 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +3 Query: 405 LPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 LP+ D R++ P V+ QG CGSCWAF A A+ Sbjct: 127 LPDEVDWRERGAVVP---RVKRQGECGSCWAFAATGAV 161 >At5g50260.1 68418.m06224 cysteine proteinase, putative similar to cysteine endopeptidase precursor CysEP GI:2944446 from [Ricinus communis] Length = 361 Score = 35.5 bits (78), Expect = 0.031 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 396 IASLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 + +LP + D W + V++QG CGSCWAF V A+ Sbjct: 123 VNTLPTSVD----WRKNGAVTPVKNQGQCGSCWAFSTVVAV 159 >At1g29080.1 68414.m03560 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 346 Score = 35.1 bits (77), Expect = 0.041 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + + V+ QG CG CWAF A+ A+ Sbjct: 136 WRNEGAVTPVKSQGECGGCWAFSAIAAV 163 >At2g27420.1 68415.m03314 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 348 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 402 SLPENFDPRDKWPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 ++ +N + D W + V+ QG CG CWAF AV A+ Sbjct: 124 NVSDNGESMD-WRQEGAVTPVKYQGRCGGCWAFSAVAAV 161 >At2g34080.1 68415.m04172 cysteine proteinase, putative contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas] Length = 345 Score = 32.7 bits (71), Expect = 0.22 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + V+ QG CG CWAF AV A+ Sbjct: 136 WRAEGAVTPVKYQGQCGCCWAFSAVAAV 163 >At3g49340.1 68416.m05394 cysteine proteinase, putative contains PS00640: Eukaryotic thiol (cysteine) proteases asparagine active site; similar to cysteine proteinase GI:535454 from [Alnus glutinosam] Length = 341 Score = 31.1 bits (67), Expect = 0.66 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 435 WPDCPTLNEVRDQGSCGSCWAFGAVEAM 518 W + V+ Q CG CWAF AV A+ Sbjct: 133 WIQEGAVTSVKHQQQCGCCWAFSAVAAV 160 >At1g29090.1 68414.m03561 peptidase C1A papain family protein contains similarity to cysteine protease SPCP1 GI:13491750 from [Ipomoea batatas]; contains Pfam profile PF00112: Papain family cysteine protease Length = 355 Score = 31.1 bits (67), Expect = 0.66 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 462 VRDQGSCGSCWAFGAVEAM 518 V+ QG CG CWAF +V A+ Sbjct: 154 VKYQGQCGCCWAFSSVAAV 172 >At1g03560.1 68414.m00337 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 660 Score = 31.1 bits (67), Expect = 0.66 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 135 CYNRKTKKMFISRAAYVTLVCVLAAAKDL 221 C++RK KK + YV+LV VLA AKD+ Sbjct: 140 CWSRKQKKYTHNLECYVSLVDVLALAKDV 168 >At5g07110.1 68418.m00810 prenylated rab acceptor (PRA1) family protein weak similarity to prenylated Rab acceptor 1 (PRA1) [Homo sapiens] GI:4877285; contains Pfam profile PF03208: Prenylated rab acceptor (PRA1) Length = 216 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = +3 Query: 114 PSIRKKVCYNRKTKKMFISRAAYVTLVCVLAAAKDLPHPLS 236 PS+ + RK F RA Y+TLV +L AA L HP + Sbjct: 60 PSLSEATSRVRKNFSYF--RANYITLVAILLAASLLTHPFA 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,333,878 Number of Sequences: 28952 Number of extensions: 296656 Number of successful extensions: 701 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -