BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E12 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 131 2e-32 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 1.2 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 6.3 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 6.3 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 8.3 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.3 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 8.3 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 131 bits (317), Expect = 2e-32 Identities = 61/111 (54%), Positives = 75/111 (67%) Frame = +2 Query: 269 DLGSSIKSDKDKFQVNLDVQHFAPEEISVKTADGYIVVEGKHXEKKDQHGYISRQFTRRY 448 D GS++ KDKFQ+NLDVQ F+PEEISVK D ++VEGKH EK+D HGY+SR F RRY Sbjct: 3 DSGSAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRY 62 Query: 449 ALPEGCTAESVESRLSSDGVLSVIAPRKVPPAVEGERKIPIAQTGPVRKEV 601 LP+G + S LSSDG+L++ PRK ER IPI TG K+V Sbjct: 63 MLPKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITHTGQPMKQV 113 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 581 RFGRSESCVHPPLLAAPSWVRLQTTHHLKTA 489 +FG CV+ ++ P W R T H+L A Sbjct: 113 QFGEGRECVNCGAISTPLWRRDGTGHYLCNA 143 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 609 WSFTSLRTGPVWAIGILRSP 550 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 609 WSFTSLRTGPVWAIGILRSP 550 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 609 WSFTSLRTGPVWAIGILRSP 550 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 609 WSFTSLRTGPVWAIGILRSP 550 W T PV+ +GI++ P Sbjct: 81 WHLTGFSIDPVYGLGIIKQP 100 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 123 YEIERPRSPHGSTFRL 170 + + +PRSPHGS R+ Sbjct: 27 HPLVQPRSPHGSGHRI 42 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 419 YISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAP 526 Y+S +F +P+GC + L + V +V+ P Sbjct: 661 YLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPP 696 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 8.3 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 609 WSFTSLRTGPVWAIGILRSP 550 W T PV+ +GI++ P Sbjct: 659 WYLTGFSIDPVYGLGIIKKP 678 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,394 Number of Sequences: 2352 Number of extensions: 13986 Number of successful extensions: 31 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -