BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E11 (652 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040035-1|AAH40035.1| 137|Homo sapiens mitochondrial ribosomal... 38 0.031 AY232291-1|AAP69986.1| 137|Homo sapiens proliferation-inducing ... 38 0.031 AL365502-8|CAI14583.1| 137|Homo sapiens mitochondrial ribosomal... 38 0.031 >BC040035-1|AAH40035.1| 137|Homo sapiens mitochondrial ribosomal protein L41 protein. Length = 137 Score = 37.9 bits (84), Expect = 0.031 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 223 RXVXXIGYNLNG-RFXXXXXXXXXXXXXNLKDFDLKPYVSYKAADVIQSEFTPSQLFDAV 399 R IG+ +G RF +L F LKPYVSY A + ++ T +QLF Sbjct: 36 RGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKLKPYVSYLAPESEETPLTAAQLFSEA 95 Query: 400 YSKKIVTDFK 429 + I DFK Sbjct: 96 VAPAIEKDFK 105 >AY232291-1|AAP69986.1| 137|Homo sapiens proliferation-inducing gene 3 protein. Length = 137 Score = 37.9 bits (84), Expect = 0.031 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 223 RXVXXIGYNLNG-RFXXXXXXXXXXXXXNLKDFDLKPYVSYKAADVIQSEFTPSQLFDAV 399 R IG+ +G RF +L F LKPYVSY A + ++ T +QLF Sbjct: 36 RGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKLKPYVSYLAPESEETPLTAAQLFSEA 95 Query: 400 YSKKIVTDFK 429 + I DFK Sbjct: 96 VAPAIEKDFK 105 >AL365502-8|CAI14583.1| 137|Homo sapiens mitochondrial ribosomal protein L41 protein. Length = 137 Score = 37.9 bits (84), Expect = 0.031 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = +1 Query: 223 RXVXXIGYNLNG-RFXXXXXXXXXXXXXNLKDFDLKPYVSYKAADVIQSEFTPSQLFDAV 399 R IG+ +G RF +L F LKPYVSY A + ++ T +QLF Sbjct: 36 RGAKGIGFLTSGWRFVQIKEMVPEFVVPDLTGFKLKPYVSYLAPESEETPLTAAQLFSEA 95 Query: 400 YSKKIVTDFK 429 + I DFK Sbjct: 96 VAPAIEKDFK 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,794,458 Number of Sequences: 237096 Number of extensions: 1143682 Number of successful extensions: 1299 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1299 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -