BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E11 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35663-2|CAA84735.2| 335|Caenorhabditis elegans Hypothetical pr... 29 3.8 AF098995-13|AAC67476.2| 95|Caenorhabditis elegans Hypothetical... 27 8.7 >Z35663-2|CAA84735.2| 335|Caenorhabditis elegans Hypothetical protein T04A8.2 protein. Length = 335 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/60 (33%), Positives = 32/60 (53%) Frame = +2 Query: 332 MFHTKPLMSFKVNLHLLNYSMLCTVRKLLPILNXENXMXKVIQXNRLXRSH*SPRKPLFV 511 MF+ +PL+ FK+ + +L++S C + L+ IL N M VI R + P K L + Sbjct: 103 MFY-EPLIGFKIMMIVLHHSRAC--KSLIQILLVVNRMSCVIYPIRYGKMWMRPLKYLII 159 >AF098995-13|AAC67476.2| 95|Caenorhabditis elegans Hypothetical protein F58E1.13 protein. Length = 95 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 67 LLINNFCKRNISVTATXEGKRNFXKFVIPNKRGSVLHKKKQMTEDREFEI 216 +L+ N+ N + T +G + F KFV N+ ++ K+ ++E EF+I Sbjct: 11 VLVINYITHNNELIYTPQGLK-FSKFVANNQNKVDIYIKETVSEKPEFDI 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,218,286 Number of Sequences: 27780 Number of extensions: 192984 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -