BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E10 (651 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC126198-1|AAI26199.1| 354|Homo sapiens opsin 5 protein. 33 1.2 BC126194-1|AAI26195.1| 354|Homo sapiens opsin 5 protein. 33 1.2 AY377391-1|AAR21109.1| 354|Homo sapiens neuropsin protein. 33 1.2 AY288419-1|AAP72128.1| 350|Homo sapiens G protein-coupled recep... 33 1.2 AL161622-1|CAI20454.1| 188|Homo sapiens protein ( Human DNA seq... 33 1.2 >BC126198-1|AAI26199.1| 354|Homo sapiens opsin 5 protein. Length = 354 Score = 32.7 bits (71), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 484 LYNAIVRSVLDYGTFLLQPGDVNAFKKLDSIQSKALRIITGAMKSSPVTALQVE 323 +YN I+ V+DY Q G + A KK S++ L +T KSS V + E Sbjct: 300 MYNPIIYQVIDYKFACCQTGGLKATKK-KSLEGFRLHTVTTVRKSSAVLEIHEE 352 >BC126194-1|AAI26195.1| 354|Homo sapiens opsin 5 protein. Length = 354 Score = 32.7 bits (71), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 484 LYNAIVRSVLDYGTFLLQPGDVNAFKKLDSIQSKALRIITGAMKSSPVTALQVE 323 +YN I+ V+DY Q G + A KK S++ L +T KSS V + E Sbjct: 300 MYNPIIYQVIDYKFACCQTGGLKATKK-KSLEGFRLHTVTTVRKSSAVLEIHEE 352 >AY377391-1|AAR21109.1| 354|Homo sapiens neuropsin protein. Length = 354 Score = 32.7 bits (71), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 484 LYNAIVRSVLDYGTFLLQPGDVNAFKKLDSIQSKALRIITGAMKSSPVTALQVE 323 +YN I+ V+DY Q G + A KK S++ L +T KSS V + E Sbjct: 300 MYNPIIYQVIDYKFACCQTGGLKATKK-KSLEGFRLHTVTTVRKSSAVLEIHEE 352 >AY288419-1|AAP72128.1| 350|Homo sapiens G protein-coupled receptor 136 protein. Length = 350 Score = 32.7 bits (71), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 484 LYNAIVRSVLDYGTFLLQPGDVNAFKKLDSIQSKALRIITGAMKSSPVTALQVE 323 +YN I+ V+DY Q G + A KK S++ L +T KSS V + E Sbjct: 297 MYNPIIYQVIDYKFACCQTGGLKATKK-KSLEGFRLHTVTTVRKSSAVLEIHEE 349 >AL161622-1|CAI20454.1| 188|Homo sapiens protein ( Human DNA sequence from clone RP3-402H5 on chromosome 6p12.3-21.1 Contains the 3' end of a gene for a novel protein similar to seven ). Length = 188 Score = 32.7 bits (71), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = -3 Query: 484 LYNAIVRSVLDYGTFLLQPGDVNAFKKLDSIQSKALRIITGAMKSSPVTALQVE 323 +YN I+ V+DY Q G + A KK S++ L +T KSS V + E Sbjct: 135 MYNPIIYQVIDYKFACCQTGGLKATKK-KSLEGFRLHTVTTVRKSSAVLEIHEE 187 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,506,158 Number of Sequences: 237096 Number of extensions: 1720845 Number of successful extensions: 2359 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2359 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -