BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E04 (651 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 2.9 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 23 2.9 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 23 2.9 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 5.0 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.8 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -3 Query: 178 YYMELLTLPQHQNLPPFFKSYSF 110 YY +P Q +PP + +Y + Sbjct: 22 YYNYTSDIPNAQQMPPHYSNYHY 44 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -3 Query: 178 YYMELLTLPQHQNLPPFFKSYSF 110 YY +P Q +PP + +Y + Sbjct: 22 YYNYTSDIPNAQQMPPHYSNYHY 44 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 22.6 bits (46), Expect = 2.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -3 Query: 178 YYMELLTLPQHQNLPPFFKSYSF 110 YY +P Q +PP + +Y + Sbjct: 22 YYNYTSDIPNAQQMPPHYSNYHY 44 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = -3 Query: 133 PFFKSYSFCRTLSLIFRSFKTLFLNKVQIKF 41 P+ KSY++ + + + F F N I F Sbjct: 46 PYLKSYTYIKLVVSVLMDFIAYFFNFWTILF 76 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 214 PIDALMRKCYPIYYMELLTLPQHQN 140 P+ L YP YY + ++ +QN Sbjct: 352 PVTNLTNLTYPSYYNQDVSCTHYQN 376 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,826 Number of Sequences: 336 Number of extensions: 1349 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -