BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E04 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 28 1.0 SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi... 27 2.3 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 28.3 bits (60), Expect = 1.0 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 532 QKEYRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +K RS+ R KL + ERD RTVF QL+ R+ ++ Sbjct: 218 RKRSRSRPRERSSKLSE---EERDRRTVFVSQLANRLTSR 254 >SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 27.1 bits (57), Expect = 2.3 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -3 Query: 298 PLIFFYLSIXYAFLNHLYPFLCAYLSACPIDALMRKCYPIYYMELLTLPQHQ 143 PLI+FY + L+HL F A S CP + R + Y + T +H+ Sbjct: 294 PLIYFY-----SILSHLLVFAYALYSLCPNSLITRLL--VQYSPIDTFAEHK 338 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,664,109 Number of Sequences: 5004 Number of extensions: 24446 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -