BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_E04 (651 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK001344-1|BAA91638.1| 406|Homo sapiens protein ( Homo sapiens ... 45 3e-04 CR457257-1|CAG33538.1| 423|Homo sapiens RNPC4 protein. 42 0.002 BC024208-1|AAH24208.1| 423|Homo sapiens RNA binding motif prote... 42 0.002 BC002566-1|AAH02566.1| 424|Homo sapiens RNA binding motif prote... 42 0.002 AF275678-1|AAG24388.1| 418|Homo sapiens PP239 protein protein. 42 0.002 AF087905-1|AAP97203.1| 425|Homo sapiens splicing factor SF2 pro... 42 0.002 AL357374-10|CAI13606.1| 231|Homo sapiens RNA binding motif prot... 40 0.006 L10911-1|AAA16347.1| 530|Homo sapiens splicing factor protein. 40 0.008 L10910-1|AAA16346.1| 524|Homo sapiens splicing factor protein. 40 0.008 BC141835-1|AAI41836.1| 530|Homo sapiens RNA binding motif prote... 40 0.008 BC131543-1|AAI31544.1| 508|Homo sapiens RBM39 protein protein. 40 0.008 AL357374-12|CAI13607.1| 193|Homo sapiens RNA binding motif prot... 40 0.008 AL357374-11|CAI13608.1| 202|Homo sapiens RNA binding motif prot... 40 0.008 AL357374-9|CAC11119.1| 524|Homo sapiens RNA binding motif prote... 40 0.008 AL357374-8|CAC11118.1| 530|Homo sapiens RNA binding motif prote... 40 0.008 AL357374-7|CAI13605.1| 336|Homo sapiens RNA binding motif prote... 40 0.008 >AK001344-1|BAA91638.1| 406|Homo sapiens protein ( Homo sapiens cDNA FLJ10482 fis, clone NT2RP2000153, weakly similar to GAR2 PROTEIN. ). Length = 406 Score = 44.8 bits (101), Expect = 3e-04 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = +1 Query: 505 KEKTPEREPQKEYRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + + RE + YRS +++L P ERD RTVFCMQL+ RIR + Sbjct: 98 RSRDHRREDRVHYRSPPLTTGEPVDNLSPEERDARTVFCMQLAARIRPR 146 >CR457257-1|CAG33538.1| 423|Homo sapiens RNPC4 protein. Length = 423 Score = 41.9 bits (94), Expect = 0.002 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 541 YRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +R KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 129 FREKSPVREP-VDNLSPEERDARTVFCMQLAARIRPR 164 >BC024208-1|AAH24208.1| 423|Homo sapiens RNA binding motif protein 23 protein. Length = 423 Score = 41.9 bits (94), Expect = 0.002 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 541 YRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +R KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 129 FREKSPVREP-VDNLSPEERDARTVFCMQLAARIRPR 164 >BC002566-1|AAH02566.1| 424|Homo sapiens RNA binding motif protein 23 protein. Length = 424 Score = 41.9 bits (94), Expect = 0.002 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 541 YRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +R KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 129 FREKSPVREP-VDNLSPEERDARTVFCMQLAARIRPR 164 >AF275678-1|AAG24388.1| 418|Homo sapiens PP239 protein protein. Length = 418 Score = 41.9 bits (94), Expect = 0.002 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 541 YRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +R KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 123 FREKSPVREP-VDNLSPEERDARTVFCMQLAARIRPR 158 >AF087905-1|AAP97203.1| 425|Homo sapiens splicing factor SF2 protein. Length = 425 Score = 41.9 bits (94), Expect = 0.002 Identities = 20/37 (54%), Positives = 27/37 (72%) Frame = +1 Query: 541 YRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 +R KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 129 FREKSPVREP-VDNLSPEERDARTVFCMQLAARIRPR 164 >AL357374-10|CAI13606.1| 231|Homo sapiens RNA binding motif protein 39 protein. Length = 231 Score = 40.3 bits (90), Expect = 0.006 Identities = 20/53 (37%), Positives = 35/53 (66%) Frame = +1 Query: 493 NVHKKEKTPEREPQKEYRSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 ++ + ++ + P ++ +S R +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 117 SIKLRRRSRSKSPFRKDKSPVR--EP-IDNLTPEERDARTVFCMQLAARIRPR 166 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >L10911-1|AAA16347.1| 530|Homo sapiens splicing factor protein. Length = 530 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >L10910-1|AAA16346.1| 524|Homo sapiens splicing factor protein. Length = 524 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >BC141835-1|AAI41836.1| 530|Homo sapiens RNA binding motif protein 39 protein. Length = 530 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >BC131543-1|AAI31544.1| 508|Homo sapiens RBM39 protein protein. Length = 508 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 111 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 145 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >AL357374-12|CAI13607.1| 193|Homo sapiens RNA binding motif protein 39 protein. Length = 193 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >AL357374-11|CAI13608.1| 202|Homo sapiens RNA binding motif protein 39 protein. Length = 202 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 111 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 145 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >AL357374-9|CAC11119.1| 524|Homo sapiens RNA binding motif protein 39 protein. Length = 524 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >AL357374-8|CAC11118.1| 530|Homo sapiens RNA binding motif protein 39 protein. Length = 530 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 133 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 167 Score = 36.3 bits (80), Expect = 0.095 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 130 MAEDFDVEAMLEAPYNKSDN 189 MA+D D+EAMLEAPY K +N Sbjct: 1 MADDIDIEAMLEAPYKKDEN 20 >AL357374-7|CAI13605.1| 336|Homo sapiens RNA binding motif protein 39 protein. Length = 336 Score = 39.9 bits (89), Expect = 0.008 Identities = 19/36 (52%), Positives = 26/36 (72%) Frame = +1 Query: 544 RSKSRGLDPKLEDLPPXERDLRTVFCMQLSQRIRAK 651 + KS +P +++L P ERD RTVFCMQL+ RIR + Sbjct: 5 KDKSPVREP-IDNLTPEERDARTVFCMQLAARIRPR 39 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 54,576,197 Number of Sequences: 237096 Number of extensions: 747731 Number of successful extensions: 3110 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3109 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -