BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_D23 (486 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 23 1.9 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 23 1.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 4.5 AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochr... 21 7.9 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.9 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 333 AFNVKITDNKKCLQYKTEVQQDVRKIXKFMS 425 A ++K+TD + Y VQQ +R F+S Sbjct: 266 ALHIKLTDTAHMINYAFCVQQLLRITVAFIS 296 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 22.6 bits (46), Expect = 1.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 333 AFNVKITDNKKCLQYKTEVQQDVRKIXKFMS 425 A ++K+TD + Y VQQ +R F+S Sbjct: 266 ALHIKLTDTAHMINYAFCVQQLLRITVAFIS 296 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 Query: 85 ILIMYLCMYSFY 50 +LI+ LC+Y FY Sbjct: 231 VLIILLCIYYFY 242 >AF264718-1|AAF75271.1| 125|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q6 protein. Length = 125 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 301 GTVLNIHIQKVH 336 GTVL+IHI +H Sbjct: 83 GTVLHIHIFDLH 94 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 7.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 298 LGTVLNIHIQKVHLMSKLLTIKSAFNTKQKY 390 LGT+L+IH K+ + L + N Q++ Sbjct: 287 LGTMLSIHPSKLDVEQMNLLHSNDLNMHQQH 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,021 Number of Sequences: 336 Number of extensions: 2502 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11315916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -