BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_D18 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 24 3.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 4.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.3 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 6.3 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding pr... 23 8.4 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 24.2 bits (50), Expect = 3.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 135 AWLSTTTVTMQMRISACSSPVPLSGTS 215 AWL T ++I+AC + PL T+ Sbjct: 155 AWLGYNKKTKLLQIAACPNQDPLEATT 181 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +3 Query: 249 CRLLHTNGSTSSIRWSVLPCSSLAVPLLLTDSNIMVRAR 365 C L N + +SV+P A +L + IM R++ Sbjct: 69 CNLRTVNSEFDNTNFSVIPAEHTAALSILCNEAIMARSK 107 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 242 YIMQTPSHKRIDIFYSLVGVALFVASGAIIIDRFQHYGKSEIKDKN 379 +I ++P H+ D F++ +G F + ++ H S IK N Sbjct: 724 FIKESPMHEITDFFHAYLG---FCVDPSSLLSPLNHKRSSGIKSFN 766 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 212 LIIFAGAAAGYIMQTPSHKRIDIFYSLV 295 +IIF GAA G ++ P R + Y+LV Sbjct: 12 VIIFIGAAHGLLVVGPKFIRANQEYTLV 39 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 6 DENDIGEKRRLAF---LDLMIETANNGANISDEE 36 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 4 DENDIGEKRRLAF---LDLMIETANNGANISDEE 34 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 5 DENDIGEKRRLAF---LDLMIETANNGANISDEE 35 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 5 DENDIGEKRRLAF---LDLMIETANNGANISDEE 35 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 406 DDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQ 305 D+ G + L F L +M+E+ NN SDE+ Sbjct: 3 DENDIGEKRRLAF---LDLMIETANNGANISDEE 33 >AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding protein AgamOBP47 protein. Length = 178 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 129 VRAWLSTTTVTMQMRISACSSP 194 VRA +STT T+Q C +P Sbjct: 6 VRALISTTISTLQNAAECCVTP 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,467 Number of Sequences: 2352 Number of extensions: 13834 Number of successful extensions: 70 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -