BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_D18 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19340.1 68418.m02305 expressed protein 28 6.2 At3g23840.1 68416.m02997 transferase family protein low similari... 28 6.2 >At5g19340.1 68418.m02305 expressed protein Length = 263 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 111 WSWHLRVRAWLSTTTVTMQMRISACSSPVPLSGTSSYS 224 W LR++ +TTT T R+S+ S S TSS S Sbjct: 160 WKELLRLKKQRTTTTTTASTRVSSLSPSSSSSSTSSSS 197 >At3g23840.1 68416.m02997 transferase family protein low similarity to hypersensitivity-related gene [Nicotiana tabacum] GI:1171577, acetyl-CoA:benzylalcohol acetyltranferase [Clarkia concinna] GI:6166330; contains Pfam profile PF02458: Transferase family Length = 420 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = -3 Query: 445 LREDSINK*DSAIDDGQRGLSQVLVFDLALTIMLESVNNNGTASDEQGNTDQRIEDVDPF 266 +R D A+ +GQ S + F +A + E V + G A DE+ D+ ++DV F Sbjct: 279 IRSDPKKLKPRAVRNGQMISSIHVDFSVAEASLEEIVKSIGEAKDERVVIDEIVDDVSDF 338 Query: 265 V 263 + Sbjct: 339 I 339 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,300,980 Number of Sequences: 28952 Number of extensions: 270041 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -