BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_D14 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 24 1.5 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 1.9 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.9 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 384 CSRVWTPSGFKIEDVDRSCSC 446 CS SG KI ++RSC C Sbjct: 57 CSSYLQVSGSKIWQMERSCMC 77 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 216 TLKNNELFNMLNCFVKNICFLLCYIIIVDSVFKIRGDSN 100 TL+N+E+ + F N+ L C I V + K +G +N Sbjct: 99 TLQNDEVLDWKKIFDINLLGLTCMIQEVLKLMKKKGINN 137 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 144 YNIVKSKYF*QNNSTY*TIHYFLM 215 YNI+ +++ N++TY T+ LM Sbjct: 235 YNILLRRHYSMNSTTYVTLTIVLM 258 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 210 KNNELFNMLNCFVKNICFLLC 148 K ELF + CFV + L C Sbjct: 413 KRKELFIAIVCFVSYLIGLFC 433 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 210 KNNELFNMLNCFVKNICFLLC 148 K ELF + CFV + L C Sbjct: 466 KRKELFIAIVCFVSYLIGLFC 486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,747 Number of Sequences: 438 Number of extensions: 3786 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -