BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_D13 (595 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0073 - 14333096-14333290,14333377-14333638,14333811-143339... 28 6.5 11_04_0112 - 13585293-13585988,13586095-13586619 27 8.5 >09_04_0073 - 14333096-14333290,14333377-14333638,14333811-14333965, 14334039-14334147,14335094-14335131 Length = 252 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 303 IVLLGLVSFFQAYIYGCYYVKPLPKYF 383 I LLGL FFQA I G KP P F Sbjct: 142 ISLLGLTDFFQAVIVGGECEKPKPAPF 168 >11_04_0112 - 13585293-13585988,13586095-13586619 Length = 406 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 284 LENXHKYRIAWTRVFFSGLY-LRLLLRKAT 370 ++ + RIA TRV + GLY L ++L KAT Sbjct: 314 MDKNNSIRIAPTRVMYHGLYILMMMLTKAT 343 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,122,289 Number of Sequences: 37544 Number of extensions: 259191 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -