BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C20 (633 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 1.1 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 1.1 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 1.1 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 1.1 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.1 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 1.9 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 1.9 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 1.9 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 1.9 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.5 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNL 73 R +E+ K K++ + + HN N Y+ L Sbjct: 68 RDRKERERSKEPKIISSLSNKTIHNNNNNYKKL 100 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNL 73 R +E+ K K++ + + HN N Y+ L Sbjct: 68 RDRKERERSKEPKIISSLSNKTIHNNNNNYKKL 100 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNL 73 R +E+ K K++ + + HN N Y+ L Sbjct: 68 RDRKERERSKEPKIISSLSNKTIHNNNNNYKKL 100 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNL 73 R +E+ K K++ + + HN N Y+ L Sbjct: 68 RDRKERERSKEPKIISSLSNKTIHNNNNNYKKL 100 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNL 73 R +E+ K K++ + + HN N Y+ L Sbjct: 301 RDRKERERSKEPKIISSLSNKTIHNNNNNYKKL 333 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNLFHPKQVSNC*KL 37 R +E+ + K++ + + HN N N + +NC KL Sbjct: 68 RDRTERERSREPKIISSLSNRTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNLFHPKQVSNC*KL 37 R +E+ + K++ + + HN N N + +NC KL Sbjct: 68 RDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNLFHPKQVSNC*KL 37 R +E+ + K++ + + HN N N + +NC KL Sbjct: 68 RDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -1 Query: 171 RSSNTKEKHKT*KVVGIVVSLAFHNRRNKYQNLFHPKQVSNC*KL 37 R +E+ + K++ + + HN N N + +NC KL Sbjct: 68 RDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.3 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 36 IVFNSLRL-VWGETNFGIYFYGCEMQAKRRYLLLFMSCAFLLY 161 + F S+ L V G F I F+GC + + + +FLL+ Sbjct: 48 LAFPSITLIVLGSIIFVISFFGCCGAIRESHCMTITFASFLLF 90 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = +3 Query: 324 FSKCGSDPKIFVYPSDGTVSASYXKVLSVIXXSTYVTXDPNE 449 + K D K+F +P D + A + ++ ++ PNE Sbjct: 640 YGKMTLDDKVFGFPLDRPMWAWNFTIPNMYFKDVFIYNRPNE 681 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = +3 Query: 324 FSKCGSDPKIFVYPSDGTVSASYXKVLSVIXXSTYVTXDPNE 449 + K D K+F +P D + A + ++ ++ PNE Sbjct: 640 YGKMTLDDKVFGFPLDRPMWAWNFTIPNMYFKDVFIYNRPNE 681 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,626 Number of Sequences: 438 Number of extensions: 3129 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -