BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C17 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 3.8 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 3.8 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 5.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.9 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.9 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 241 LDKLKAERERGITIDIALWKFETXKYYVTII 333 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 241 LDKLKAERERGITIDIALWKFETXKYYVTII 333 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 321 CYHH*CSXTQXFHQEHDHRNLS 386 C H + FH+EHD R S Sbjct: 251 CDDHRDRPPRHFHEEHDTRRAS 272 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.1 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +2 Query: 32 HAVCNPVTNQKWARKR 79 + +CN + NQ+W R Sbjct: 907 YEICNRIRNQRWIVNR 922 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 72 LAHFWLVTGLQTACNIR 22 L H WL TGL T+ ++ Sbjct: 113 LLHDWLGTGLLTSTGLK 129 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 72 LAHFWLVTGLQTACNIR 22 L H WL TGL T+ ++ Sbjct: 113 LLHDWLGTGLLTSTGLK 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,425 Number of Sequences: 336 Number of extensions: 2594 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -