BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C13 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81571-11|CAC35914.1| 1579|Caenorhabditis elegans Hypothetical p... 27 8.7 AL132848-7|CAC35915.1| 1579|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z81571-11|CAC35914.1| 1579|Caenorhabditis elegans Hypothetical protein M01G12.12 protein. Length = 1579 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 505 ETEAAIFILQRFLSLRPGHNGQLDVLLHRTGVLRHXDG 618 E++ A+FILQR++ + PG + + VL+ L +G Sbjct: 1308 ESKKAVFILQRYIYMIPGLDSVMFVLMRWGEALELFEG 1345 >AL132848-7|CAC35915.1| 1579|Caenorhabditis elegans Hypothetical protein M01G12.12 protein. Length = 1579 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 505 ETEAAIFILQRFLSLRPGHNGQLDVLLHRTGVLRHXDG 618 E++ A+FILQR++ + PG + + VL+ L +G Sbjct: 1308 ESKKAVFILQRYIYMIPGLDSVMFVLMRWGEALELFEG 1345 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,761,299 Number of Sequences: 27780 Number of extensions: 260565 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -