BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C09 (371 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 1.3 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 3.1 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 1.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +1 Query: 160 TKNCLDYVQRMKIETVLINCI*QHIXKI 243 TK C +++ + I+ +++ CI +HI I Sbjct: 52 TKKCY-FLRMVLIDLLIVGCILKHIFNI 78 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 21.4 bits (43), Expect = 3.1 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -2 Query: 226 VKYNLLILFQFSFFVHSPNNFL*LYISSTNLRFFYYQL 113 ++Y L+Q S + + +++ + +TNL F QL Sbjct: 144 LRYEHYRLYQLSVLIDNNMSYIIIVSFATNLYFIIIQL 181 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,691 Number of Sequences: 336 Number of extensions: 1158 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 7722305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -