BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C09 (371 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058318-1|AAL13547.1| 872|Drosophila melanogaster GH08353p pro... 29 2.0 AE014296-3271|AAF49077.2| 872|Drosophila melanogaster CG14183-P... 29 2.0 >AY058318-1|AAL13547.1| 872|Drosophila melanogaster GH08353p protein. Length = 872 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 135 RLVEEMYNYKKLFGLCTKNEN*NSINKLYLTTYXKNKL 248 R EE+Y KK+ L N+ NSI ++Y K KL Sbjct: 279 RFKEELYGMKKIRKLKRPNQTANSIMEMYKNEMLKKKL 316 >AE014296-3271|AAF49077.2| 872|Drosophila melanogaster CG14183-PA protein. Length = 872 Score = 29.1 bits (62), Expect = 2.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 135 RLVEEMYNYKKLFGLCTKNEN*NSINKLYLTTYXKNKL 248 R EE+Y KK+ L N+ NSI ++Y K KL Sbjct: 279 RFKEELYGMKKIRKLKRPNQTANSIMEMYKNEMLKKKL 316 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,033,881 Number of Sequences: 53049 Number of extensions: 159239 Number of successful extensions: 299 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 984962268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -