BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_C09 (371 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80029-19|AAB37598.1| 139|Caenorhabditis elegans Hypothetical p... 28 1.9 AC025715-2|AAK68447.2| 439|Caenorhabditis elegans Hypothetical ... 27 3.2 >U80029-19|AAB37598.1| 139|Caenorhabditis elegans Hypothetical protein T20D4.19 protein. Length = 139 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 58 HVKSCWLKMTLITE--Y*LNSTGNRRI*DWWKKCTTTKNCLDYVQ 186 H +C+L++ E Y L+ T + ++ K CT+ +CL+ +Q Sbjct: 42 HAINCFLRLADYVEKMYELDMTDKTEVNEFEKSCTSLTSCLETIQ 86 >AC025715-2|AAK68447.2| 439|Caenorhabditis elegans Hypothetical protein Y38F2AR.6 protein. Length = 439 Score = 27.5 bits (58), Expect = 3.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 109 NSTGNRRI*DWWKKCTT 159 N +G RR+ DW KCTT Sbjct: 154 NKSGGRRVSDWIVKCTT 170 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,578,499 Number of Sequences: 27780 Number of extensions: 95811 Number of successful extensions: 215 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 215 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 535612900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -