BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B24 (619 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 27 2.9 SPBC2A9.05c |||DUF846 family protein|Schizosaccharomyces pombe|c... 26 5.0 SPCC645.08c |snd1||RNA-binding protein Snd1|Schizosaccharomyces ... 25 6.6 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.8 SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|ch... 25 8.8 SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schiz... 25 8.8 SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 25 8.8 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 26.6 bits (56), Expect = 2.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 442 HCTYFFVIFFTNLIVAYILSLLGRDQ*ERST 350 HC Y F TN++V+ +L LLG Q ST Sbjct: 130 HCVYLFYCISTNVLVSSLL-LLGGSQGFSST 159 >SPBC2A9.05c |||DUF846 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 219 Score = 25.8 bits (54), Expect = 5.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 433 YFFVIFFTNLIVAYILSL 380 +FF++F T IVAYIL + Sbjct: 52 FFFLLFRTGAIVAYILGM 69 >SPCC645.08c |snd1||RNA-binding protein Snd1|Schizosaccharomyces pombe|chr 3|||Manual Length = 878 Score = 25.4 bits (53), Expect = 6.6 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +2 Query: 449 PADDQLVTQYCEPENPWKHVPATNRAQIAADYLELCRRYNTTPIDSVLXPDQ 604 P+DD +VT+ P NP K + A ++ + +E R + + L P Q Sbjct: 142 PSDDVVVTEKANPANPAKFLKA-HKGKKLNGIVETIRNGDQVRVRLFLSPKQ 192 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 449 EMTLYVFFCYFFH*SHCR 396 E Y FF +FF SHCR Sbjct: 72 EAFFYWFFFFFFFFSHCR 89 >SPAC1250.02 |mug95||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 178 Score = 25.0 bits (52), Expect = 8.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 487 RKPLETCSGNESRSDSGGLFGVVQAVQHDADRLRA 591 RKPL++ NE S G V+ + H A L A Sbjct: 90 RKPLQSEGINEDDSQKNGELIVLHGINHQAAMLTA 124 >SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 25.0 bits (52), Expect = 8.8 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +2 Query: 428 KIRTVSFPADDQLVTQYCEPENPWKHVPATNRAQIAADYLELCRRYNTTPIDS 586 KIR V DD T CE W+H N C + PID+ Sbjct: 3 KIRCVCPFEDDDGFTIQCESCEVWQHAVCVNIDANNVPEKYFCEQCQPRPIDA 55 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 25.0 bits (52), Expect = 8.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 402 MRLVKKITKKYVQCHFPPTIS*SHSTASQKTLGNMFR 512 + L+K+ K+Y + H P IS S Q+ G FR Sbjct: 166 VNLLKRSLKRYNELHIPFDISTPSSEEKQQASGLNFR 202 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,553,086 Number of Sequences: 5004 Number of extensions: 50630 Number of successful extensions: 137 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -