BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B24 (619 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035704-1|AAH35704.1| 180|Homo sapiens Unknown (protein for IM... 42 0.002 AL360270-1|CAI17128.1| 769|Homo sapiens chromosome 1 open readi... 30 7.5 >BC035704-1|AAH35704.1| 180|Homo sapiens Unknown (protein for IMAGE:5573062) protein. Length = 180 Score = 41.9 bits (94), Expect = 0.002 Identities = 15/53 (28%), Positives = 30/53 (56%) Frame = +2 Query: 434 RTVSFPADDQLVTQYCEPENPWKHVPATNRAQIAADYLELCRRYNTTPIDSVL 592 + V+FP+D+ +V+ EP++PW+H ++ Y + C++ N I +L Sbjct: 44 KRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLL 96 >AL360270-1|CAI17128.1| 769|Homo sapiens chromosome 1 open reading frame 103 protein. Length = 769 Score = 29.9 bits (64), Expect = 7.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 490 KPLETCSGNESRSDSGGLFGVVQAVQHDADRL 585 KP E SGN SR SG ++ VVQ + D L Sbjct: 11 KPAEENSGNASRCVSGCMYQVVQTIGSDGKNL 42 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,478,816 Number of Sequences: 237096 Number of extensions: 1725795 Number of successful extensions: 3776 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3776 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6635341780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -