BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B24 (619 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62830.1 68418.m07886 F-box family protein-related similar to... 28 4.3 At2g45840.1 68415.m05701 expressed protein 27 10.0 >At5g62830.1 68418.m07886 F-box family protein-related similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 204 Score = 28.3 bits (60), Expect = 4.3 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -3 Query: 425 CYFFH*SHCRIHFEPSRSGSVRTEHMRCLYQDRQT 321 C FH CR+ + VR EH+ YQ RQT Sbjct: 68 CAHFHHQPCRV--DTIALSVVREEHLSLFYQSRQT 100 >At2g45840.1 68415.m05701 expressed protein Length = 523 Score = 27.1 bits (57), Expect = 10.0 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +2 Query: 437 TVSFPADDQLVTQYCEPENPWKHVPATNRAQIAADY 544 T+ D + TQ C NP K P+ + + DY Sbjct: 87 TLQCSLDQNIATQTCPASNPEKSQPSKDEPETCPDY 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,315,863 Number of Sequences: 28952 Number of extensions: 263973 Number of successful extensions: 647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -