BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B20 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase ... 28 1.0 SPAC11D3.15 |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||M... 27 2.4 SPCC162.10 |ppk33||serine/threonine protein kinase Ppk33 |Schizo... 27 3.1 SPBC18H10.15 |ppk23||serine/threonine protein kinase Ppk23|Schiz... 26 5.5 SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos... 25 7.3 >SPAC1805.01c |ppk6|SPAPJ736.02c|serine/threonine protein kinase Ppk6|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 28.3 bits (60), Expect = 1.0 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 220 LIESQFYYSNLVTRDIYLFF*RFRILKKNL 131 L ES YS+L+T+DI L F F+++ + L Sbjct: 346 LFESMLGYSDLLTKDISLIFPDFKLVLQQL 375 >SPAC11D3.15 |||oxoprolinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1317 Score = 27.1 bits (57), Expect = 2.4 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -3 Query: 342 SFELDDSGTTAIVTDTMHISRSAKANLGFIMFNKTFLASEN*LNLNF 202 SF LDDS T +I + AKANL F ++ ++ E LN + Sbjct: 546 SFTLDDSNTESIKKRFDSLKEEAKANLEEQGFTESQISYELFLNCRY 592 >SPCC162.10 |ppk33||serine/threonine protein kinase Ppk33 |Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 369 NFLLYNWLISFELDDSGTTAIVTDTMHISRSAK 271 N LL NW+ + E + + + ++ +HISR K Sbjct: 233 NHLLINWIRASEEEKASSADRLSSALHISRDKK 265 >SPBC18H10.15 |ppk23||serine/threonine protein kinase Ppk23|Schizosaccharomyces pombe|chr 2|||Manual Length = 398 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 290 CIVSVTIAVVPLSSSSNEINQLYK 361 CI + I PL S +E++QLYK Sbjct: 262 CIFAEMITRTPLFSGKSELDQLYK 285 >SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizosaccharomyces pombe|chr 2|||Manual Length = 1706 Score = 25.4 bits (53), Expect = 7.3 Identities = 13/47 (27%), Positives = 19/47 (40%) Frame = -1 Query: 155 IPNTKKKFNAQNKIKQFPTRSWRAYRNNIRYVIFEFESWNTRSPPDA 15 + TK N N +Q R Y N +++ E WN PP + Sbjct: 889 VKKTKINLNGINYKRQSGLRELNTYPNAPLHILPETIFWNPERPPSS 935 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,744,882 Number of Sequences: 5004 Number of extensions: 57385 Number of successful extensions: 146 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -