BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B08 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20980| Best HMM Match : AlaDh_PNT_N (HMM E-Value=0.11) 31 0.62 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 >SB_20980| Best HMM Match : AlaDh_PNT_N (HMM E-Value=0.11) Length = 253 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 331 KFYTIKMDE-ADIKTEXDMVLVIVEDEPXDGYXEIVNKFEKNIXXECDVXNMIETAAK 501 K++T + D+ +KT+ D ++I++D+P G E++ +F + D+ M+ K Sbjct: 73 KYHTRERDQQTQLKTQIDTFILILQDQP--GAKEVIGRFTRGGGAILDIEYMLNEEGK 128 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 163 SGYCLERLCKSQMNNRLARLKIYCRKSQLCRLKSEEI 53 +G LER+C++ N + ++K C+ Q C + + I Sbjct: 216 AGLNLERVCETNPGNTMQKVKGQCQNEQACEVVASNI 252 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,942,787 Number of Sequences: 59808 Number of extensions: 297578 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -