BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B08 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 4.8 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 24 4.8 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = +1 Query: 61 RFLNDTIEIFCNIF*AWQADCSFVIYITFLNSIRYKSDNQNFV 189 RF+ DTI ++F ++A+C FL+++R + +NF+ Sbjct: 174 RFVLDTI---ASVFFGFEANCIHNSEDPFLSTLRRANRGRNFI 213 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 484 IETAAKHGHFIDIKVEPAEXEDTWXXIDYDY 576 +ETA K G DI V P + D ++ DY Sbjct: 66 LETARKLGDRFDIVVAPHKLADFTETLESDY 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,843 Number of Sequences: 2352 Number of extensions: 9893 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -