BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B06 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 1.5 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.5 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/50 (28%), Positives = 28/50 (56%) Frame = +3 Query: 66 IAEQIATLCATLGEYPSVRYRSDWERNVELAQLIQQKLDAYKADEPTMGE 215 +A +T+ + +VR++++ ERN+ + KLD +A++ T GE Sbjct: 51 VAHGKSTIVKAISGVQTVRFKNELERNITI------KLDT-RAEDSTRGE 93 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = +1 Query: 424 QHIAVVSTAVTKNLXKFTESKRMGGGDKQSMRDLSQMIKKMPQYQKELSKYATHL 588 Q VVS + L + + ++GGG +Q++ L + + Q + + Y +L Sbjct: 667 QQYQVVSVEQYQQLKEQGQISQVGGGIQQNVEVLPENLVNAQQQVQAVRNYYANL 721 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,361 Number of Sequences: 438 Number of extensions: 3474 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -