BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B05 (567 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 28 0.064 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.4 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 22 4.2 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 27.9 bits (59), Expect = 0.064 Identities = 22/78 (28%), Positives = 35/78 (44%) Frame = +1 Query: 142 LTSCTLITHIIIMEDKASLKELDQWIQQLNECKQLTENQVKTLCDKAKEILTKESNVQXV 321 LT + + ++I+ E LK DQ + +C L + + +K K+ +T+ V Sbjct: 14 LTYVSSVEYLILREIDTILKN-DQMTRNYLDCV-LDKGKCTKEAEKLKKGITETMKNGCV 71 Query: 322 KCPVTVCGDVHGQFHDLM 375 KC DVH F LM Sbjct: 72 KCEQKQKEDVHKVFQHLM 89 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 142 LTSCTLITHIIIMEDKASLKELDQWIQQLNE 234 L C L TH ++KASL + ++ LN+ Sbjct: 1116 LFKCMLCTHQKAGDEKASLINIADSLEMLNK 1146 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 142 LTSCTLITHIIIMEDKASLKELDQWIQQLNE 234 L C L TH ++KASL + ++ LN+ Sbjct: 1116 LFKCMLCTHQKAGDEKASLINIADSLEMLNK 1146 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 142 LTSCTLITHIIIMEDKASLKELDQWIQQLNE 234 L C L TH ++KASL + ++ LN+ Sbjct: 1116 LFKCMLCTHQKAGDEKASLINIADSLEMLNK 1146 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 142 LTSCTLITHIIIMEDKASLKELDQWIQQLNE 234 L C L TH ++KASL + ++ LN+ Sbjct: 1116 LFKCMLCTHQKAGDEKASLINIADSLEMLNK 1146 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +1 Query: 181 EDKASLKELDQWIQQLNECKQLTENQVKTLCDK 279 ED+ ++K + ++++ + +LTEN V L +K Sbjct: 20 EDQYTIKYDNVNLKEILQSDRLTENYVNCLLEK 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,623 Number of Sequences: 336 Number of extensions: 2093 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -