BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_B04 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 164 4e-41 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 31 0.47 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 30 1.4 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) 29 2.5 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 28 5.8 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 164 bits (399), Expect = 4e-41 Identities = 78/95 (82%), Positives = 87/95 (91%), Gaps = 2/95 (2%) Frame = +2 Query: 194 RNVRSLEKV--CADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSKTWDRFQMRI 367 + VR+ KV CADLI GAK++KL+VKGPVRMPTK LRITTRKTPCGEGSKTWDR++MRI Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRI 65 Query: 368 HKRVIDLHSPSEIVKQITSINIEPGVXVEVTIADA 472 HKR+IDLHSPSEIVKQITSI+IEPGV VEVTIADA Sbjct: 66 HKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 100 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 199 CALAREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 312 C A GLC P + ++ + GPSP + DP+ P Sbjct: 414 CLCAPSGLCVPIHFLPNSDPSLAGPSPSSKLDPSIRDP 451 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 128 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 229 + + K Q E + IH + +T ++VRSLE+ C + Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 479 EPPIKYF*KKKXXXKKKKKKKK 544 +PP K KKK KKKKKKKK Sbjct: 145 QPPTKKKKKKKKKKKKKKKKKK 166 >SB_9375| Best HMM Match : Sec6 (HMM E-Value=0.35) Length = 1049 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -1 Query: 493 FYWRLCLRVGDGHLNLYTGLDVN*GDLFHDFRGRV*VDHSLVDSHLK 353 FY L L V D L G+D DLF + R VD+SLV +K Sbjct: 405 FYSNLVLEVSDNETELVNGIDQLWDDLFVESRR---VDYSLVSVKMK 448 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 27.9 bits (59), Expect = 5.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 268 GPSPHANQDPAYHHP 312 GP PH+ Q P HHP Sbjct: 1189 GPPPHSMQQPLLHHP 1203 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +1 Query: 163 YPPHQDHSYFTQCALAR---EGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 312 Y P +SY CA + +G + A+ + PH N DPA+ P Sbjct: 267 YDPQNPYSYGAYCAYTQAQPQGFNAQAYPYENNSASARPAMPHYNSDPAHTEP 319 >SB_41095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 512 FFFFKNILLAALPTRRRWSPQP 447 F +N+++ LPT +RW P P Sbjct: 176 FLSKRNVVIQRLPTSQRWQPYP 197 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,649,343 Number of Sequences: 59808 Number of extensions: 370539 Number of successful extensions: 1185 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -