Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P02_F_A22
         (551 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    25   0.33 
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    23   1.8  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   7.2  

>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 25.4 bits (53), Expect = 0.33
 Identities = 14/60 (23%), Positives = 30/60 (50%)
 Frame = -3

Query: 411 FIHLQLDNHTL*RVNADICCCTIGLFSLNPXNVYNKLFTIHLHHFANLLAFVVSTYNLNF 232
           F   +L+N++L  +N  +    +GL+ LN  + ++   +I      N + F V+ +  +F
Sbjct: 316 FCKKKLENYSLQLINHRVVFTAMGLYVLNMEHFFSVKCSIQSESLLNDILFPVAGFISDF 375


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -2

Query: 385 HTLKGECRHMLLHHWPFL 332
           HT + +C H LL H P L
Sbjct: 352 HTPEPDCIHELLGHMPLL 369


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 339 GQWCNSICRHSP 374
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 339 GQWCNSICRHSP 374
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 339 GQWCNSICRHSP 374
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 339 GQWCNSICRHSP 374
           G W N I RHSP
Sbjct: 266 GWWENYISRHSP 277


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,821
Number of Sequences: 336
Number of extensions: 2609
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13621010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)