BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_A22 (551 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 0.33 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 1.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 25.4 bits (53), Expect = 0.33 Identities = 14/60 (23%), Positives = 30/60 (50%) Frame = -3 Query: 411 FIHLQLDNHTL*RVNADICCCTIGLFSLNPXNVYNKLFTIHLHHFANLLAFVVSTYNLNF 232 F +L+N++L +N + +GL+ LN + ++ +I N + F V+ + +F Sbjct: 316 FCKKKLENYSLQLINHRVVFTAMGLYVLNMEHFFSVKCSIQSESLLNDILFPVAGFISDF 375 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 385 HTLKGECRHMLLHHWPFL 332 HT + +C H LL H P L Sbjct: 352 HTPEPDCIHELLGHMPLL 369 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 339 GQWCNSICRHSP 374 G W N I RHSP Sbjct: 266 GWWENYISRHSP 277 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 339 GQWCNSICRHSP 374 G W N I RHSP Sbjct: 266 GWWENYISRHSP 277 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 339 GQWCNSICRHSP 374 G W N I RHSP Sbjct: 266 GWWENYISRHSP 277 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 339 GQWCNSICRHSP 374 G W N I RHSP Sbjct: 266 GWWENYISRHSP 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,821 Number of Sequences: 336 Number of extensions: 2609 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -