BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_A17 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0055 + 25235844-25235872,25237026-25237932 28 5.6 02_05_0417 - 28796121-28796743,28796829-28796925,28797010-287970... 28 5.6 >05_06_0055 + 25235844-25235872,25237026-25237932 Length = 311 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -1 Query: 479 GLL-AAEVCSTLRAHXHHHCWMAAFF 405 GLL AA + +TL AH HHH AA++ Sbjct: 194 GLLNAATMPATLAAHHHHHHHAAAYY 219 >02_05_0417 - 28796121-28796743,28796829-28796925,28797010-28797093, 28797173-28797234,28797316-28797460,28797542-28797961, 28798041-28798090,28798163-28798349,28798426-28798680, 28798785-28798953,28799044-28799177,28799291-28799446, 28799534-28799719,28799798-28799962,28800074-28800190, 28800553-28800762,28800850-28801049,28801135-28801405, 28801481-28801547,28801644-28801942,28802425-28802991 Length = 1487 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +3 Query: 123 IRYXDFDKKRYIPFKMAD--KTIPIFVPSEKP 212 I+Y DF K I F MAD ++IP V KP Sbjct: 644 IKYSDFINKELIQFSMADLLRSIPSMVDGLKP 675 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,025,397 Number of Sequences: 37544 Number of extensions: 310860 Number of successful extensions: 716 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -