BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_A12 (512 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 3.8 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 25 6.7 >SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.8 bits (54), Expect = 3.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 191 VKVRKCASTCKCYEYLLACADVVFLKCYFILCVLTIYVL 307 + +RK K E++L + L CY +L VL YV+ Sbjct: 391 ILLRKKEDCKKLLEHVLPIRQLFLLNCYSLLNVLANYVV 429 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 25.0 bits (52), Expect = 6.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 197 VRKCASTCKCYEYL 238 VR C + CKC EYL Sbjct: 126 VRFCIAICKCIEYL 139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,663,735 Number of Sequences: 5004 Number of extensions: 27745 Number of successful extensions: 42 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 206265012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -