BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_A01 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 25 2.1 AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 25 2.1 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 8.4 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 161 GVPVLVRNIRKFSLRIQKVFSRII*KRPPERASNPLPTPFS 39 GV L R+ +KF+L+ + + ++ P +N + +PFS Sbjct: 46 GVDRLQRSSQKFALQFYQYVTELVDYNPNVTTTNIIVSPFS 86 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 25.0 bits (52), Expect = 2.1 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = +1 Query: 118 LSENLRMFLTSTGTPWK-WPINNLFHYGQLTCEWHTGITXLLIPER----XCCLVXYIEG 282 L + + F+ S P WP HY ++ EW+ L +P+ C IE Sbjct: 219 LQKRILPFIRSHDHPVMFWPDLASCHYSKVVREWYAEKGVLFVPKNLNPPNCPQFRPIEK 278 Query: 283 YW 288 YW Sbjct: 279 YW 280 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.0 bits (47), Expect = 8.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 202 VVHSGTGCLWATSKVCQYSSGTY 134 +V+ G G + + K+C SGTY Sbjct: 594 LVYVGRGLVQRSGKLCARRSGTY 616 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,240 Number of Sequences: 2352 Number of extensions: 14097 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -