BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P22 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 39 4e-05 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 21 6.7 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 21 6.7 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 8.8 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 38.7 bits (86), Expect = 4e-05 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 5/84 (5%) Frame = +1 Query: 97 KVIHRDIKPENLLIGHNWELKIADFGWS--VHSPSSRRMTLCGTLD--YLSPEMIEGKPH 264 +V+HRD+ N+L+ N +K++DFG S V+ + G L +++ E + + + Sbjct: 612 RVVHRDLAARNVLVCENHTVKVSDFGLSRDVYQDNVYCKNGGGKLPVRWMALESLTHQRY 671 Query: 265 NYAVXIWSLGVLCYELL-VGLPPF 333 +WS GVL +E++ +G P+ Sbjct: 672 TTYSDVWSFGVLLWEIVTLGGTPY 695 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 61 HECKLQRFFHQIG 23 + ++QRF HQIG Sbjct: 362 YNLEIQRFIHQIG 374 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 61 HECKLQRFFHQIG 23 + ++QRF HQIG Sbjct: 362 YNLEIQRFIHQIG 374 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 582 LVKFXKQHKMLFLLSIH*WWMSTF 511 LVK K H L+ L + W TF Sbjct: 240 LVKVAKDHNSLYSLHLLLWITVTF 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,856 Number of Sequences: 336 Number of extensions: 3365 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -