BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P16 (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0279 - 23794964-23795111,23795486-23795634,23796120-237962... 54 7e-08 01_06_1123 + 34671365-34671883,34672366-34672625,34673045-346731... 54 7e-08 07_01_0849 + 6896930-6896996,6897453-6897474,6897615-6897690,689... 53 2e-07 03_05_0593 - 25959013-25959789 33 0.11 04_03_0395 - 15356255-15356292,15356507-15356620,15356728-153568... 30 1.3 07_01_1199 + 11391638-11391718,11393477-11393590,11393690-113938... 29 1.7 07_01_0917 + 7735696-7735896,7735907-7736404,7736481-7736813,773... 29 1.7 10_07_0113 - 12993300-12993413,12993493-12993775,12993856-129940... 29 3.1 08_01_0978 + 9841441-9842169,9842303-9842590,9842768-9843612,984... 29 3.1 05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 28 5.3 12_02_0466 + 19403855-19404347,19404359-19404582,19404659-194050... 27 7.1 12_01_0857 - 8043765-8043839,8044215-8044497,8044578-8044748,804... 27 7.1 04_03_0227 + 12979635-12980363,12980439-12980474,12980604-129808... 27 7.1 04_03_0116 - 11448012-11448525,11448693-11448763,11449139-114494... 27 7.1 05_07_0285 + 28982502-28982782,28982888-28982989,28983189-289840... 27 9.3 >05_05_0279 - 23794964-23795111,23795486-23795634,23796120-23796221, 23796309-23796384,23796578-23796588 Length = 161 Score = 54.0 bits (124), Expect = 7e-08 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 179 AKVTWTVLYRRKFKKGQEEEQAKKRTXRTQK-FQRAIVGASLSDIMAXRNMKPEV 340 AK+TWT +YR++ KK E KKR T+K + R+IVGASL I R KPEV Sbjct: 49 AKLTWTAMYRKQHKKDIHAEAVKKRRRTTKKPYSRSIVGASLEVIQKKRAEKPEV 103 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 39 MKIGLCAYSGYKIYPGHG 92 +K LC +SG KIYPG G Sbjct: 3 LKTELCRFSGQKIYPGKG 20 >01_06_1123 + 34671365-34671883,34672366-34672625,34673045-34673143, 34673237-34675178,34675588-34675658,34676158-34676307, 34676963-34677038,34677131-34677232,34677707-34677855, 34678214-34678364 Length = 1172 Score = 54.0 bits (124), Expect = 7e-08 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +2 Query: 179 AKVTWTVLYRRKFKKGQEEEQAKKRTXRTQK-FQRAIVGASLSDIMAXRNMKPEV 340 AK+TWT +YR++ KK E KKR T+K + R+IVGA+L I R+ KPEV Sbjct: 1059 AKLTWTAMYRKQHKKDIHAEAVKKRRRTTKKPYSRSIVGATLEVIQKKRSEKPEV 1113 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 51 LCAYSGYKIYPGHG 92 LC +SG KIYPG G Sbjct: 1017 LCRFSGQKIYPGKG 1030 >07_01_0849 + 6896930-6896996,6897453-6897474,6897615-6897690, 6897775-6897876,6898156-6898304,6898637-6898784 Length = 187 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 179 AKVTWTVLYRRKFKKGQEEEQAKKRTXRTQK-FQRAIVGASLSDIMAXRNMKPEV 340 AK+TWT +YR++ KK E KKR T+K + R+IVGA+L I R KPEV Sbjct: 75 AKLTWTAMYRKQHKKDIHAEAVKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEV 129 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 33 VKMKIGLCAYSGYKIYPGHG 92 +K+ LC +SG KIYPG G Sbjct: 27 LKVWTELCRFSGAKIYPGKG 46 >03_05_0593 - 25959013-25959789 Length = 258 Score = 33.5 bits (73), Expect = 0.11 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 300 SEAPTIARWNFWVLXVRFFACSSSWP-FLNLRLYRTVHVTLARIPPHQMG 154 +E P+ + +L + F CSS+ P FL+ R R HV +A PP G Sbjct: 46 AEGPSSSMSPTSILETKQFCCSSAMPPFLSERSLRKAHVEMAAAPPEPAG 95 >04_03_0395 - 15356255-15356292,15356507-15356620,15356728-15356809, 15356862-15357236,15357256-15357320,15357534-15357662, 15357759-15357854,15357959-15357983 Length = 307 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -2 Query: 194 SMLL*RGFLLIKWAASHFEFRNVKVFPSTLSHGLAMAWIYFV 69 +M++ RG LL+ + ++R K FP+ L HG+ IYFV Sbjct: 238 NMVVWRGELLLIIRHYNGDYRGCKSFPAGLHHGVEGDHIYFV 279 >07_01_1199 + 11391638-11391718,11393477-11393590,11393690-11393826, 11393905-11394064 Length = 163 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 100 WLKVDGKTFTFLNSKCEAAHLMRRNPR 180 +++ D K F F SKC M+RNPR Sbjct: 21 FVRNDAKIFRFCRSKCHKNFKMKRNPR 47 >07_01_0917 + 7735696-7735896,7735907-7736404,7736481-7736813, 7736991-7737314,7737367-7737836,7738165-7738447, 7738527-7738640 Length = 740 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -2 Query: 170 LLIKWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 + +KW++ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 617 ITLKWSSVHYLNSNIKPEIYDWSAIESALNEAWDQYVARGGRHKDGHPKLGHKKDFPI 674 >10_07_0113 - 12993300-12993413,12993493-12993775,12993856-12994026, 12994104-12994948,12995035-12995307,12995549-12995953 Length = 696 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 161 KWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 KW+ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 576 KWSLVHYLNSNIKPEIYDWSAIESALNEAWDQYVARDGKHKDRHPKLGHKKDFPI 630 >08_01_0978 + 9841441-9842169,9842303-9842590,9842768-9843612, 9843941-9844223,9844303-9844416 Length = 752 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = -2 Query: 170 LLIKWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 + +KW+ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 629 ITLKWSRVHYLNSNIKPEIYDWSAIESALNEAWDQYVARGGRHKDGHPKLGHKKDFPI 686 >05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 Length = 454 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 167 LIKWAASHFEFRNVKVFPSTLS--HGLAMAW 81 +++WA H +F +VF +++S HG + W Sbjct: 313 MLQWAREHMDFATTRVFFTSMSPTHGKSQDW 343 >12_02_0466 + 19403855-19404347,19404359-19404582,19404659-19405093, 19405180-19406024,19406353-19406635,19406903-19406977 Length = 784 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 161 KWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 KW+ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 677 KWSLVHYLNSNIKPEIYDWSAIESALNEAWDQYVARGGRHKDGHPKLGHKKDFPI 731 >12_01_0857 - 8043765-8043839,8044215-8044497,8044578-8044748, 8044826-8045670,8045828-8046262,8046339-8046563, 8046700-8046781,8046814-8047067 Length = 789 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 161 KWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 KW+ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 682 KWSLVHYLNSNIKPEIYDWSAIESSLNEAWDQYVARGGRHKDGHPKLGHKKDFPI 736 >04_03_0227 + 12979635-12980363,12980439-12980474,12980604-12980873, 12980962-12981099,12981347-12981795,12981885-12982055, 12982136-12982370 Length = 675 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -2 Query: 158 WAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSIN 3 W+ H+ N+K ++ S + + L AW +V+ G D H L +KD I+ Sbjct: 610 WSLVHYLNSNIKPEIYDWSAIEYALNKAWDQYVTRGGRHKDGHPKLGHKKDFPIH 664 >04_03_0116 - 11448012-11448525,11448693-11448763,11449139-11449421, 11449520-11449672,11449750-11450219,11451470-11451631, 11451718-11451987,11452229-11452633 Length = 775 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 161 KWAASHFEFRNVK--VFP-STLSHGLAMAWIYFVSTIGAKSDLHFDLTKRKDLSI 6 KW+ H+ N+K ++ S + L AW +V+ G D H L +KD I Sbjct: 498 KWSLVHYLNSNIKPEIYDWSAIESALNEAWDQYVARGGRHKDGHPKLGHKKDFPI 552 >05_07_0285 + 28982502-28982782,28982888-28982989,28983189-28984006, 28984594-28985050,28985203-28985242 Length = 565 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +2 Query: 167 GGILAKVTWTVLYRR-KFKKGQEEEQAK 247 GGILA T LYRR ++K+G ++ Q++ Sbjct: 151 GGILATTATTNLYRRQRYKEGMKDIQSQ 178 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,806,191 Number of Sequences: 37544 Number of extensions: 193014 Number of successful extensions: 528 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -