BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P15 (511 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 49 3e-06 SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) 27 6.8 SB_7139| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 1e-06 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = +2 Query: 281 CGVISPRFDVPINDIERW-TNLLPSRQF 361 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 67 MVRMNVLSDALKSIHNAEKRGKRQVLIRP 153 MVR+NVL+DAL SI NAEKRGKRQV IRP Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRP 29 Score = 29.5 bits (63), Expect = 1.7 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 164 VIVKFLTVMMKHGYIGEFEIVDDHRAGKIVVN-LTGRLNKCGVISPR 301 VIVKFLTVMMKH V R G++V +G L+ GV+ R Sbjct: 33 VIVKFLTVMMKH--------VAQPRIGEMVTRPCSGALSAAGVVVTR 71 >SB_50281| Best HMM Match : Utp21 (HMM E-Value=1.1) Length = 549 Score = 27.5 bits (58), Expect = 6.8 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +2 Query: 290 ISPRFDVPINDIERWTNLLPSRQ---FGYLVLTTSGGIMDHEEARXK 421 ISP F VP D ++ ++L+PS+Q G+L+ + S + EE K Sbjct: 381 ISPIFTVPKKDGKKKSSLIPSQQITFLGFLIDSMSTTVRLTEEKSTK 427 >SB_7139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 124 RGKRQVLIRPXFQSHR*VFNSDDEARLH 207 RG R ++ P Q HR V++ DD A ++ Sbjct: 527 RGDRAMIYLPLNQEHRPVYHRDDRAMIY 554 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,101,820 Number of Sequences: 59808 Number of extensions: 230751 Number of successful extensions: 1096 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -