SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P01_F_P15
         (511 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase...    23   4.5  
AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450 CY...    23   7.9  
AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding pr...    23   7.9  
AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding pr...    23   7.9  

>AF004915-1|AAB94671.1|  688|Anopheles gambiae pro-phenol oxidase
           subunit 1 protein.
          Length = 688

 Score = 23.4 bits (48), Expect = 4.5
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 308 VPINDIERWTNLLPSRQFGYLVLTTSGGIMDHEEARXKHLGGKIL 442
           V +ND+ERW + +        VL  SG  +  +E R   + G ++
Sbjct: 304 VSVNDLERWRDRIHEAIDQGFVLDKSGNRIMLDEQRGIDILGDVV 348


>AY176048-1|AAO19579.1|  521|Anopheles gambiae cytochrome P450
           CYP12F4 protein.
          Length = 521

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 9/30 (30%), Positives = 14/30 (46%)
 Frame = +2

Query: 320 DIERWTNLLPSRQFGYLVLTTSGGIMDHEE 409
           D   W N       G LVL +  G++D ++
Sbjct: 198 DFNEWLNRWAFETMGVLVLDSRLGVLDKDQ 227


>AY146747-1|AAO12062.1|  288|Anopheles gambiae odorant-binding
           protein AgamOBP42 protein.
          Length = 288

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 305 DVPINDIERWTN 340
           D+P +D E+WT+
Sbjct: 165 DIPFSDFEQWTS 176


>AJ618931-1|CAF02009.1|  288|Anopheles gambiae odorant-binding
           protein OBPjj83d protein.
          Length = 288

 Score = 22.6 bits (46), Expect = 7.9
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +2

Query: 305 DVPINDIERWTN 340
           D+P +D E+WT+
Sbjct: 165 DIPFSDFEQWTS 176


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 437,629
Number of Sequences: 2352
Number of extensions: 7568
Number of successful extensions: 21
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46091631
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -