BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P11 (653 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O31542 Cluster: YfnD protein; n=2; Bacillus subtilis|Re... 35 2.0 UniRef50_UPI0001597342 Cluster: YfnD; n=1; Bacillus amyloliquefa... 34 3.4 >UniRef50_O31542 Cluster: YfnD protein; n=2; Bacillus subtilis|Rep: YfnD protein - Bacillus subtilis Length = 311 Score = 34.7 bits (76), Expect = 2.0 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -2 Query: 580 WPRK*YTNXRILRSF*KNIFLWNFPSYYXSNRSSFCYTQRTQSDFYHFS 434 WP + + +++S N LWN +Y + Y T FYHFS Sbjct: 196 WPEQ-FKGVHVVKSIGANTALWNIENYKVGQKDGRVYIDETPLIFYHFS 243 >UniRef50_UPI0001597342 Cluster: YfnD; n=1; Bacillus amyloliquefaciens FZB42|Rep: YfnD - Bacillus amyloliquefaciens FZB42 Length = 312 Score = 33.9 bits (74), Expect = 3.4 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -2 Query: 580 WPRK*YTNXRILRSF*KNIFLWNFPSYYXSNRSSFCYTQRTQSDFYHFS 434 WP + + + + S N LWN Y S R Y T FYHFS Sbjct: 196 WPAQ-FEDVHVTESIGANAALWNIEQYDVSLRGGAVYVNDTPLIFYHFS 243 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,603,714 Number of Sequences: 1657284 Number of extensions: 9714525 Number of successful extensions: 19702 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19696 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49173558301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -