BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P10 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 211 2e-56 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 1.6 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 23 6.3 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 211 bits (515), Expect = 2e-56 Identities = 99/142 (69%), Positives = 121/142 (85%) Frame = +2 Query: 44 TKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM 223 +K+IKA E D+FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+ Sbjct: 5 SKVIKAGNGEPDAFETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPV 64 Query: 224 PKLKAFXKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVY 403 PK KAF K+Q RLVRELEKKFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VY Sbjct: 65 PKQKAFQKVQTRLVRELEKKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVY 124 Query: 404 NAILEDLVFPAEIVGKRIRVQV 469 +AILEDLVFPAE+VGKRIRV++ Sbjct: 125 DAILEDLVFPAEVVGKRIRVKL 146 Score = 95.1 bits (226), Expect = 2e-21 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +3 Query: 465 KLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYXKLTGREVTFEFPEPYL 608 KLDGSQLIKVHLDKNQQTTIEHKVDTF SVY KLTGR+VTFEFPE YL Sbjct: 145 KLDGSQLIKVHLDKNQQTTIEHKVDTFASVYKKLTGRDVTFEFPENYL 192 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 625 VIG*VYK*GSGNSKVTSRPVSXLYTDWKV 539 VI V K G G++ + RP+S L TD+K+ Sbjct: 503 VIVLVRKKGGGDAMSSIRPISLLNTDYKL 531 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 542 LPVCIQXANGTRSDLRVPRTLFVNLAYD 625 LPV Q T +PRT V YD Sbjct: 46 LPVAYQQKAATSGPFHMPRTEHVGYTYD 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,266 Number of Sequences: 2352 Number of extensions: 12230 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -