BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P09 (375 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0108 - 12628711-12629178 29 0.90 06_01_0471 - 3341839-3341881,3341987-3342080,3344724-3344914,334... 29 1.2 08_02_0751 + 20789843-20789908,20791152-20791313,20791516-207915... 27 3.6 07_01_0991 - 8358309-8358338,8359115-8359393,8359964-8360092,836... 27 3.6 07_01_1067 + 9437996-9438093,9438368-9438419,9440437-9440511,944... 27 4.8 05_01_0438 + 3475017-3475484 27 4.8 08_02_0640 - 19636968-19638230 27 6.3 >01_03_0108 - 12628711-12629178 Length = 155 Score = 29.5 bits (63), Expect = 0.90 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -1 Query: 285 KHKRVHVSIILRTKLFFRCTMFXYYXRRFAP*APCGGGTFLSCHASKEKC 136 KHK+V ++++ K+ T R+ P A CG GTF++ H + C Sbjct: 94 KHKKVKLAVLQFYKVD-DATGKVTRLRKECPNAECGAGTFMANHFDRHYC 142 >06_01_0471 - 3341839-3341881,3341987-3342080,3344724-3344914, 3345025-3345248 Length = 183 Score = 29.1 bits (62), Expect = 1.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 96 CFSTRRDGGCGGRNISLYLRG 158 C RRDGGCGG + + + G Sbjct: 87 CLHRRRDGGCGGGYVKVKMEG 107 >08_02_0751 + 20789843-20789908,20791152-20791313,20791516-20791566, 20792096-20792160,20792385-20792459,20792603-20792780, 20793171-20793353,20793436-20793549,20793627-20793736, 20793826-20793904,20794035-20794172 Length = 406 Score = 27.5 bits (58), Expect = 3.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 170 PSFLATQVKRNVPTATTAIAPSAKALAA 87 P+ ++ V VPTATTA AP+A AA Sbjct: 112 PAPVSEPVTAPVPTATTASAPAAAVTAA 139 >07_01_0991 - 8358309-8358338,8359115-8359393,8359964-8360092, 8360317-8360598,8361400-8361525,8363490-8363870 Length = 408 Score = 27.5 bits (58), Expect = 3.6 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 140 NVPTATTAIAPSAKALAADVL 78 ++PT TTA +P+ KAL D+L Sbjct: 25 HLPTTTTAASPALKALGEDLL 45 >07_01_1067 + 9437996-9438093,9438368-9438419,9440437-9440511, 9441455-9441523,9443711-9444232 Length = 271 Score = 27.1 bits (57), Expect = 4.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 111 RDGGCGGRNISLYLRGKKGRFPHR 182 RDGG GGR SL +R + GR R Sbjct: 101 RDGGIGGRCPSLPIRSRGGRAGER 124 >05_01_0438 + 3475017-3475484 Length = 155 Score = 27.1 bits (57), Expect = 4.8 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -1 Query: 285 KHKRVHVSIILRTKLFFRCTMFXYYXRRFAP*APCGGGTFLSCHASKEKC 136 KHK+V ++++ K+ T R+ P CG GTF++ H + C Sbjct: 94 KHKKVKLAVLQFYKVD-DATGKVTRLRKECPNNDCGAGTFMANHFDRHYC 142 >08_02_0640 - 19636968-19638230 Length = 420 Score = 26.6 bits (56), Expect = 6.3 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = -2 Query: 170 PSFLATQVKRNVPTAT-----TAIAPSAKALAADVLLPCELEFLVIAKWQFIC 27 P LA QV R +P A+ P + A + LLP L L + F C Sbjct: 24 PRDLAVQVLRFLPAQVDRACFAAVCPQWRGAARNALLPAPLPLLALPDGAFYC 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,711,866 Number of Sequences: 37544 Number of extensions: 162824 Number of successful extensions: 378 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 600754600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -