BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P09 (375 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 0.70 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 3.7 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 5.0 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 22 6.5 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 22 8.7 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 189 APCGGGTFLSCHASKEKCSDRHNR 118 A GG TFLSC+A + +D R Sbjct: 81 AEIGGTTFLSCYAPPRQPTDEFER 104 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.0 bits (47), Expect = 3.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 92 LML*H*ARWRLWRSEHFSLLAWQERKVPPPHGAQGANR 205 LM + AR+R+ +H LL + R+ P G A++ Sbjct: 123 LMATNAARYRMVAGKHIHLLEFGLRRAQGPDGGLSASK 160 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 5.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 189 APCGGGTFLSCHAS 148 A GG TF+SC+AS Sbjct: 78 ADIGGITFISCYAS 91 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 146 LLAWQERKVPPPHGAQ 193 LL WQ+R PP+ A+ Sbjct: 932 LLPWQDRNNLPPYAAR 947 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 189 APCGGGTFLSCHA 151 A GG TFLSC+A Sbjct: 137 AKVGGITFLSCYA 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 334,624 Number of Sequences: 2352 Number of extensions: 5962 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28804305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -