BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P08 (616 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81510-4|CAB04164.1| 839|Caenorhabditis elegans Hypothetical pr... 28 6.1 AF040661-17|AAG24227.2| 336|Caenorhabditis elegans Serpentine r... 27 8.1 >Z81510-4|CAB04164.1| 839|Caenorhabditis elegans Hypothetical protein F21D9.5 protein. Length = 839 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 303 KERSVFLKLWLLNSLQCNLDLVKVLS 226 K+ +VFLKLW++ NL L+++ S Sbjct: 100 KDINVFLKLWIIGCANINLKLLEINS 125 >AF040661-17|AAG24227.2| 336|Caenorhabditis elegans Serpentine receptor, class h protein59 protein. Length = 336 Score = 27.5 bits (58), Expect = 8.1 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = -3 Query: 461 DVTSKKN*HSFDSVNELTL*YHLLTIPKMFLTLMSFTYISLTKSLSESDNLQ 306 + T ++N FDS + L YH+ I + L++++F YI L K+LS ++ Sbjct: 8 NTTCRENYTYFDSSDYLRNAYHVTAIFTVPLSILAF-YIILKKTLSRMKTMK 58 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,523,384 Number of Sequences: 27780 Number of extensions: 199518 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -