BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_P03 (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.44 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 24 1.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 1.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 1.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 3.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 4.1 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 5.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 5.4 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.4 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 9.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.44 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +2 Query: 365 GNSAVSSVHSWT--NTSHYCVRSKTITSTG 448 G A H+W N Y VRS+T+TS G Sbjct: 12 GTVAADFQHNWQVGNEYTYLVRSRTLTSLG 41 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 578 PITKLFHSRNIPNILLQSSYKMCNYFETHVH 486 P T +FH PN+ S N F T+ H Sbjct: 170 PQTIVFHLETHPNVTWYSQCVTFNAFPTYTH 200 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 364 GQLCCFECTQLDEY 405 G CC+ C Q +EY Sbjct: 463 GDTCCWVCDQCEEY 476 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 364 GQLCCFECTQLDEY 405 G CC+ C Q +EY Sbjct: 553 GDTCCWVCDQCEEY 566 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 300 ENIPVFWVLGALYLTTAPEAAW 365 E I + LGA + T EA+W Sbjct: 135 EKISTLYALGAKIIRTPTEASW 156 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 87 SINLSDPAVQSYILYSGILGLKLLAVTILTGRVRYAK 197 S +L+ P + Y+L++ IL + +TI+ V Y K Sbjct: 290 STSLALPLLGKYLLFTMILVGLSVVITIVILNVHYRK 326 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +3 Query: 252 DDPDVERVRRAHLNDLENIPVFWV 323 + PD+ L+D++N+ FW+ Sbjct: 190 EQPDLNYYNPVVLDDMQNVLRFWL 213 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +3 Query: 252 DDPDVERVRRAHLNDLENIPVFWV 323 + PD+ L+D++N+ FW+ Sbjct: 190 EQPDLNYYNPVVLDDMQNVLRFWL 213 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 61 ETSRERSRDRRERGRSREHRIIP 83 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 309 ETSRERSRDRRGRGRSREHRIIP 331 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 309 ECSRDRSSERVSLVQRRGHRTSP 241 E SR+RS +R + R HR P Sbjct: 310 ETSRERSRDRRERGRSREHRIIP 332 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 360 AWATLLFRVYTAGRILHTIVY 422 AW L ++ AG HTI+Y Sbjct: 244 AWQMLFRKLPFAGLHSHTIIY 264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,448 Number of Sequences: 438 Number of extensions: 3930 Number of successful extensions: 25 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -