BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O21 (483 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60250.1 68414.m06785 zinc finger (B-box type) family protein... 31 0.41 At5g35210.2 68418.m04175 peptidase M50 family protein / sterol-r... 30 0.71 At5g35210.1 68418.m04174 peptidase M50 family protein / sterol-r... 30 0.71 At5g13290.2 68418.m01527 protein kinase family protein contains ... 29 1.6 At5g13290.1 68418.m01526 protein kinase family protein contains ... 28 2.9 At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD fin... 28 3.8 At3g56690.1 68416.m06306 calmodulin-binding protein identical to... 27 5.0 At5g37220.1 68418.m04470 zinc finger (C3HC4-type RING finger) fa... 27 6.6 At5g26340.1 68418.m03148 hexose transporter, putative strong sim... 27 6.6 >At1g60250.1 68414.m06785 zinc finger (B-box type) family protein contains similarity to zinc finger protein GI:3618320 from [Oryza sativa] Length = 251 Score = 31.1 bits (67), Expect = 0.41 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = -2 Query: 302 HYLCMYSNHE*QNQ*CRGHSKKGMIPQRLCERDYRCQRIHQPMVCCYCCTN*HNCQ*NSP 123 H + +N+ Q Q GH ++ + +R C D C+R M C C + N P Sbjct: 103 HVVHHNNNNNHQQQHVGGHQRRAEMFERSCHGDNNCERWMFAMRCELCVASNSNAVVYCP 162 Query: 122 SH 117 +H Sbjct: 163 TH 164 >At5g35210.2 68418.m04175 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains PFam PF02163: sterol-regulatory element binding protein (SREBP) site 2 protease Length = 1409 Score = 30.3 bits (65), Expect = 0.71 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 98 MSPTSYNEMENSTDNCVSLYSNSSIPLVDGSSDTCSLAHTVFVESSLFCCD 250 ++ +S NE ++ C + SN +DG+SD C + ++ +L CCD Sbjct: 380 VTDSSTNESKDLDSRCTNGGSNEVSSDLDGNSDECRICG---MDGTLLCCD 427 >At5g35210.1 68418.m04174 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains PFam PF02163: sterol-regulatory element binding protein (SREBP) site 2 protease Length = 1576 Score = 30.3 bits (65), Expect = 0.71 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 98 MSPTSYNEMENSTDNCVSLYSNSSIPLVDGSSDTCSLAHTVFVESSLFCCD 250 ++ +S NE ++ C + SN +DG+SD C + ++ +L CCD Sbjct: 380 VTDSSTNESKDLDSRCTNGGSNEVSSDLDGNSDECRICG---MDGTLLCCD 427 >At5g13290.2 68418.m01527 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 331 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = +3 Query: 246 VTSTLLVLLFMIGVHTKVVAPSIITARTRSILNDFNMSCDDTGKLILKPRPANSSLF*IL 425 +TS ++V+ + G+ T +V+ ++ RSI+ + G ++ P+ SL L Sbjct: 58 ITSKVIVISIVSGILTGLVSALVLAFLVRSIVKFMKQTPILKGPVVFSPKITPKSLHAAL 117 Query: 426 SNFVHI 443 SN + + Sbjct: 118 SNGIQL 123 >At5g13290.1 68418.m01526 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 376 Score = 28.3 bits (60), Expect = 2.9 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +3 Query: 246 VTSTLLVLLFMIGVHTKVVAPSIITARTRSILNDFNMSCDDTGKLILKPRPANSSLF*IL 425 +TS ++V+ + G+ T +V+ ++ RSI+ + G ++ P+ SL L Sbjct: 58 ITSKVIVISIVSGILTGLVSALVLAFLVRSIVKFMKQTPILKGPVVFSPKITPKSLHAAL 117 Query: 426 SN 431 SN Sbjct: 118 SN 119 >At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD finger protein-related contains Pfam profiles PF03107: DC1 domain, weak hit to PF00628: PHD-finger Length = 513 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -2 Query: 299 YLCMYSNHE*QNQ*CRGHSKKGMIPQRLCERDYRCQRIHQPMVCCYCCTN*H-NC 138 Y+ Y + E CRG G LCE C YCCT H NC Sbjct: 396 YMVRYKHDEHYLTFCRGDEAGGSDWCELCEGKLAIGGKEGFYKCTYCCTTLHINC 450 >At3g56690.1 68416.m06306 calmodulin-binding protein identical to calmodulin-binding protein GI:6760428 from [Arabidopsis thaliana] Length = 1022 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = -3 Query: 163 IAVQTDTIVSRILHLIVAGWRHAITSVK 80 I V + T S ILH+I+ G RH++++++ Sbjct: 549 IGVPSSTQRSDILHIILRGMRHSLSNIQ 576 >At5g37220.1 68418.m04470 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 214 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/51 (25%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -3 Query: 301 TTFVCTPIMNSKTNNVEVTAKKG*FHKDCVSET-TGVRGSINQWYAAIAVQ 152 T +C +NS++++ + + FH+ C+ E+ + VRG+I + A+ ++ Sbjct: 159 TCSICMENLNSESSSENIISCLHLFHQSCIFESESSVRGNIMKPCEALKIR 209 >At5g26340.1 68418.m03148 hexose transporter, putative strong similarity to hexose transporter, Lycopersicon esculentum, GI:5734440; contains Pfam profile PF00083: major facilitator superfamily protein Length = 526 Score = 27.1 bits (57), Expect = 6.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 132 LLTIVSVCTAIAAYHWLMDPL 194 +L +V +CT +AA+ W PL Sbjct: 387 ILVVVMICTYVAAFAWSWGPL 407 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,304,159 Number of Sequences: 28952 Number of extensions: 178873 Number of successful extensions: 528 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -