BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O18 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein ... 25 0.64 AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein ... 25 0.64 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.6 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 4.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 4.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.5 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 6.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 6.0 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 6.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.9 >DQ855483-1|ABH88170.1| 117|Apis mellifera chemosensory protein 2 protein. Length = 117 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 213 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 118 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AJ973398-1|CAJ01445.1| 117|Apis mellifera hypothetical protein protein. Length = 117 Score = 25.0 bits (52), Expect = 0.64 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -3 Query: 213 FLRRAEHCMGKVAEAPESPVSKCVSSMSPIVV 118 +LRR C + EAP PV + + S++P+V+ Sbjct: 47 YLRRQLKCA--LGEAPCDPVGRRLKSLAPLVL 76 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 314 DIFNGKKYEDIC 349 D+ N +KYED+C Sbjct: 597 DLSNERKYEDVC 608 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 279 FPVLDVDISTILHGR 235 FPVL V I+ +LHG+ Sbjct: 8 FPVLFVIINVLLHGQ 22 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 132 TSKTHTLRPETPGPQ 176 T H PETPGPQ Sbjct: 462 TPHHHPHPPETPGPQ 476 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 586 CFDGDDALLTAGFQHGAQQFXAA 518 C D DD LL G++ AA Sbjct: 670 CLDDDDTLLEVALSLGSEALSAA 692 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 344 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 378 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 258 CPHPKPESTATLKFTWLGLISSMVKSM 338 CP P TWLG ++S + + Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPL 379 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 258 CPHPKPESTATLKFTWLGLISSMVKSM 338 CP P TWLG ++S + + Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPL 379 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -3 Query: 531 NSLPLSKSVR--NCVPRSPSGILRSSRRSPLSAIR 433 N L + +R N PSG +RS+ +P+S R Sbjct: 412 NVLDIDDDIRHKNSAANPPSGYIRSAFGTPISTGR 446 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +3 Query: 258 CPHPKPESTATLKFTWLGLISSMVKSM 338 CP P TWLG ++S + + Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPL 379 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 400 LVVFALHVRYVHVVCG 353 LV FAL +R +VCG Sbjct: 707 LVTFALVLRPTDIVCG 722 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,645 Number of Sequences: 438 Number of extensions: 4383 Number of successful extensions: 23 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -