BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O17 (624 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 21 7.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.8 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 297 PCLLTVTKLPFSQKGTLRPFHGEKLGLNMLXSL 395 P LT+ + KG + + GE+ L +L S+ Sbjct: 51 PITLTIPVPQAANKGMINQYGGEQPTLRLLCSI 83 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 163 QRSTKRPMRPNPLIPIFDMLSASY 92 Q+ R +RP P+ FD++ Y Sbjct: 628 QKKKHRAIRPEPIDAQFDIIQNIY 651 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,424 Number of Sequences: 438 Number of extensions: 3639 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -