BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P01_F_O16 (639 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0460 - 14294931-14295110,14295200-14295234,14295358-142954... 28 5.4 01_05_0439 - 22159425-22159520,22160137-22160345,22161028-221610... 28 5.4 >05_03_0460 - 14294931-14295110,14295200-14295234,14295358-14295457, 14295548-14295669,14296272-14296367,14296489-14298949 Length = 997 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 179 LQGLCLQHCSWCIARSQPL*SELKSSANTPAAKIVIKTVFHISCKQGN 36 ++GLC Q IAR+ L E+KSS P ++ +K V C++G+ Sbjct: 322 IEGLCQQKD---IARAVKLFKEMKSSGVAPDVRL-LKKVIEAFCREGD 365 >01_05_0439 - 22159425-22159520,22160137-22160345,22161028-22161066, 22161196-22161356,22161447-22161518,22162002-22162183, 22162580-22162703,22164196-22164299,22165526-22165725, 22165838-22166069,22166156-22166239,22166329-22166386, 22166724-22166771,22167924-22168081,22168451-22168501, 22168585-22168658,22168760-22168835,22169685-22169729, 22169833-22169899,22169978-22170095,22170580-22170775, 22171551-22171640,22171985-22172039,22172755-22172975, 22173362-22173454,22173608-22173721,22173918-22173981, 22174081-22174181,22174306-22174447,22174528-22174729, 22174883-22174976,22176172-22176348 Length = 1248 Score = 28.3 bits (60), Expect = 5.4 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 252 IEEAKPNGALDEVF-KKYCDKSAQLKGCISSVLQGVRXCVGNEYANHINDAQNSTNQLID 428 I+ A P+G + F KK + Q +S ++Q + +Y N+A+ +TN L+D Sbjct: 421 IDNASPSGFNTQAFLKKRSRATNQPVESMSMIMQFIETQGFLDYLERCNNAEENTNNLLD 480 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,268,704 Number of Sequences: 37544 Number of extensions: 344600 Number of successful extensions: 913 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -